Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|6452
Gene name
Locationscaffold_565:5689..7853
Strand+
Gene length (bp)2164
Transcript length (bp)1866
Coding sequence length (bp)1863
Protein length (aa) 621

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF03547 Mem_trans Membrane transport protein 3.6E-45 125 606

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|P38355|YB8B_YEAST Uncharacterized transporter YBR287W OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YBR287W PE=1 SV=1 124 261 2.0E-42
sp|P38355|YB8B_YEAST Uncharacterized transporter YBR287W OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YBR287W PE=1 SV=1 442 618 4.0E-40
sp|O14197|YDQ4_SCHPO Uncharacterized transporter C5D6.04 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC5D6.04 PE=3 SV=1 126 314 2.0E-38
sp|O14197|YDQ4_SCHPO Uncharacterized transporter C5D6.04 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC5D6.04 PE=3 SV=1 430 617 1.0E-33

GO

GO Term Description Terminal node
GO:0016021 integral component of membrane Yes
GO:0055085 transmembrane transport Yes
GO:0009987 cellular process No
GO:0051234 establishment of localization No
GO:0006810 transport No
GO:0110165 cellular anatomical entity No
GO:0031224 intrinsic component of membrane No
GO:0005575 cellular_component No
GO:0051179 localization No
GO:0008150 biological_process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 33 0.45

Transmembrane Domains

Domain # Start End Length
1 128 150 22
2 160 182 22
3 436 458 22
4 478 500 22
5 521 543 22
6 556 575 19
7 596 618 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
SC16a Pure fungal culture 103.27 54.54 152.00
CcL In ants, during behavior modification 316.09 134.52 497.66
CcD In ants, recently dead 78.59 42.18 115.01

Differential expression

Label1 Label2 Q-value Significant difference
SC16a CcL 0.000286 yes
SC16a CcD 0.245046 no
CcL CcD 0.000286 yes

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|6452
MPAPSISPSLRDKDILQNTALALRAIVSSSAADDALRLRLLRINRHGQQTSLSNTLRGPGRREVEAHDGICQFLR
RARLIPSGPRCPECLRLPDGRPPRTADGPPLATSPVSPRLRSRPRGRLHKQKFLANLNVMLFTPCLIFTKLASQL
NAEKLTELAIIPAIFVLQTVISWIVSTLMARAFRFNRRASNFVTAMGVFGNSNSLPISLVLSLSQTIKGLHWDRI
AGDNDDEVAARGILYLLIFQQLGQLVRWSWGYHVLLAPKDKYPEYQQQIVEEGEGRYGEAHSEQETRRLIDGFDD
GETEDDDERHSVDSRTYVPDGQTPLAGTSRTSADSSDDESAPKKLQHPKCAPRAEIAPRSVPHTLAFPRVGSSGD
RSPPRTRSDGIWASHKASAANGFRSLQARTSRCLDSLGKRIPDPVRVLLSVLRTASRKTAYFIWEFMNPPLWAML
IAVTVASIPALQKLFFEEESFINNSVTSAVKSSGGVAVPLILVVLGANLARNTMARDDSHDPEEEQVGTKLLVAA
LLSRMVLPTVIMAPILALMAKYLPVSILDDPIFIVVCFLLTGAPSALQLAQICQINAVYEKTMGRVLFQSYVIWI
LPSTLILVMMALEVVQWAAAP
Coding >Ophio5|6452
ATGCCTGCGCCCTCCATCTCACCATCGCTGCGCGATAAGGATATTTTGCAGAATACGGCCTTGGCGCTGCGCGCT
ATTGTCTCCTCGTCTGCGGCCGATGACGCATTGAGACTTCGCCTCCTCCGGATCAACCGACACGGTCAACAAACG
TCACTTTCTAACACGCTTCGCGGACCTGGACGCCGCGAAGTCGAGGCTCACGATGGAATCTGCCAATTCCTTCGC
CGGGCCCGTCTCATACCGTCTGGCCCACGTTGCCCGGAATGCCTACGACTACCCGATGGCCGTCCTCCAAGGACA
GCCGACGGGCCACCCCTCGCTACCTCACCTGTGTCTCCTCGTCTTCGAAGCCGTCCTCGAGGTCGTCTGCACAAG
CAGAAATTTCTGGCCAACCTCAATGTCATGTTGTTTACCCCATGCCTGATCTTTACGAAACTGGCATCCCAACTA
AACGCCGAGAAGCTGACCGAGCTCGCCATTATCCCCGCCATCTTTGTCCTCCAGACCGTGATATCGTGGATTGTC
TCCACCCTGATGGCCAGGGCCTTTCGATTCAACCGACGAGCCTCCAACTTCGTCACTGCCATGGGTGTCTTCGGC
AACTCGAATTCTCTACCCATCTCTCTCGTCCTCTCCCTTTCACAGACCATCAAGGGGCTCCACTGGGATCGCATT
GCAGGGGATAACGACGATGAAGTCGCCGCCCGAGGCATCCTCTATCTCCTCATATTTCAGCAACTTGGCCAGCTG
GTCCGATGGAGCTGGGGGTACCATGTGCTGCTTGCCCCCAAGGACAAATACCCCGAGTACCAGCAACAAATTGTC
GAAGAGGGCGAGGGCCGCTACGGCGAGGCCCACAGCGAGCAGGAAACCCGACGGCTTATCGACGGCTTCGACGAC
GGAGAGACTGAAGACGACGACGAGCGCCATAGTGTCGACTCTCGCACGTATGTGCCTGACGGCCAGACCCCGCTT
GCCGGCACCTCGAGGACTTCGGCCGACTCGAGCGACGACGAGTCCGCACCCAAGAAGCTGCAGCATCCCAAGTGC
GCCCCTCGAGCCGAAATTGCTCCCAGGAGCGTGCCCCATACTCTGGCCTTTCCCCGGGTCGGCAGCAGCGGCGAC
CGCAGCCCGCCTCGCACCAGGTCCGACGGCATCTGGGCTTCGCACAAGGCGTCGGCCGCCAACGGGTTTCGTTCT
CTGCAAGCCAGGACATCTCGCTGCCTGGATAGCCTCGGCAAGAGGATACCGGACCCGGTCCGTGTACTCCTGTCA
GTCCTGAGGACGGCCTCGAGAAAGACGGCGTATTTCATCTGGGAGTTTATGAACCCGCCGCTGTGGGCGATGCTC
ATTGCCGTCACGGTTGCGTCGATTCCTGCGCTTCAGAAGCTCTTCTTCGAGGAGGAATCGTTCATCAACAACAGC
GTGACGAGTGCCGTCAAGTCGAGCGGCGGCGTTGCCGTTCCCCTGATCCTGGTCGTTCTGGGCGCCAACCTTGCG
AGAAACACGATGGCGCGGGACGACAGCCACGACCCCGAAGAGGAGCAGGTCGGAACCAAGCTCCTGGTGGCGGCC
TTGTTGAGCCGGATGGTCCTACCGACCGTCATCATGGCTCCGATCCTGGCTCTCATGGCAAAGTACTTGCCCGTC
AGCATTCTTGACGATCCCATCTTCATCGTCGTCTGCTTCCTACTGACCGGTGCCCCGAGCGCGTTGCAGCTGGCT
CAGATCTGCCAGATCAACGCCGTGTACGAGAAGACGATGGGCCGGGTGCTCTTCCAGAGCTACGTCATATGGATT
CTACCTTCCACGTTGATCCTTGTCATGATGGCTCTCGAAGTTGTACAGTGGGCGGCTGCGCCA
Transcript >Ophio5|6452
ATGCCTGCGCCCTCCATCTCACCATCGCTGCGCGATAAGGATATTTTGCAGAATACGGCCTTGGCGCTGCGCGCT
ATTGTCTCCTCGTCTGCGGCCGATGACGCATTGAGACTTCGCCTCCTCCGGATCAACCGACACGGTCAACAAACG
TCACTTTCTAACACGCTTCGCGGACCTGGACGCCGCGAAGTCGAGGCTCACGATGGAATCTGCCAATTCCTTCGC
CGGGCCCGTCTCATACCGTCTGGCCCACGTTGCCCGGAATGCCTACGACTACCCGATGGCCGTCCTCCAAGGACA
GCCGACGGGCCACCCCTCGCTACCTCACCTGTGTCTCCTCGTCTTCGAAGCCGTCCTCGAGGTCGTCTGCACAAG
CAGAAATTTCTGGCCAACCTCAATGTCATGTTGTTTACCCCATGCCTGATCTTTACGAAACTGGCATCCCAACTA
AACGCCGAGAAGCTGACCGAGCTCGCCATTATCCCCGCCATCTTTGTCCTCCAGACCGTGATATCGTGGATTGTC
TCCACCCTGATGGCCAGGGCCTTTCGATTCAACCGACGAGCCTCCAACTTCGTCACTGCCATGGGTGTCTTCGGC
AACTCGAATTCTCTACCCATCTCTCTCGTCCTCTCCCTTTCACAGACCATCAAGGGGCTCCACTGGGATCGCATT
GCAGGGGATAACGACGATGAAGTCGCCGCCCGAGGCATCCTCTATCTCCTCATATTTCAGCAACTTGGCCAGCTG
GTCCGATGGAGCTGGGGGTACCATGTGCTGCTTGCCCCCAAGGACAAATACCCCGAGTACCAGCAACAAATTGTC
GAAGAGGGCGAGGGCCGCTACGGCGAGGCCCACAGCGAGCAGGAAACCCGACGGCTTATCGACGGCTTCGACGAC
GGAGAGACTGAAGACGACGACGAGCGCCATAGTGTCGACTCTCGCACGTATGTGCCTGACGGCCAGACCCCGCTT
GCCGGCACCTCGAGGACTTCGGCCGACTCGAGCGACGACGAGTCCGCACCCAAGAAGCTGCAGCATCCCAAGTGC
GCCCCTCGAGCCGAAATTGCTCCCAGGAGCGTGCCCCATACTCTGGCCTTTCCCCGGGTCGGCAGCAGCGGCGAC
CGCAGCCCGCCTCGCACCAGGTCCGACGGCATCTGGGCTTCGCACAAGGCGTCGGCCGCCAACGGGTTTCGTTCT
CTGCAAGCCAGGACATCTCGCTGCCTGGATAGCCTCGGCAAGAGGATACCGGACCCGGTCCGTGTACTCCTGTCA
GTCCTGAGGACGGCCTCGAGAAAGACGGCGTATTTCATCTGGGAGTTTATGAACCCGCCGCTGTGGGCGATGCTC
ATTGCCGTCACGGTTGCGTCGATTCCTGCGCTTCAGAAGCTCTTCTTCGAGGAGGAATCGTTCATCAACAACAGC
GTGACGAGTGCCGTCAAGTCGAGCGGCGGCGTTGCCGTTCCCCTGATCCTGGTCGTTCTGGGCGCCAACCTTGCG
AGAAACACGATGGCGCGGGACGACAGCCACGACCCCGAAGAGGAGCAGGTCGGAACCAAGCTCCTGGTGGCGGCC
TTGTTGAGCCGGATGGTCCTACCGACCGTCATCATGGCTCCGATCCTGGCTCTCATGGCAAAGTACTTGCCCGTC
AGCATTCTTGACGATCCCATCTTCATCGTCGTCTGCTTCCTACTGACCGGTGCCCCGAGCGCGTTGCAGCTGGCT
CAGATCTGCCAGATCAACGCCGTGTACGAGAAGACGATGGGCCGGGTGCTCTTCCAGAGCTACGTCATATGGATT
CTACCTTCCACGTTGATCCTTGTCATGATGGCTCTCGAAGTTGTACAGTGGGCGGCTGCGCCATGA
Gene >Ophio5|6452
ATGCCTGCGCCCTCCATCTCACCATCGCTGCGCGATAAGGATATTTTGCGTGCCTCCCGTCCCGCTTTGCCCATT
TTCCCTCTCCTCCCACCTCACATCAAGCGCCTCTCACCCCCTCGTAGAGAATACGGCCTTGGCGCTGCGCGCTAT
TGTCTCCTCGTCTGCGGCCGATGACGCATTGAGACTGTCCGTTCGCGCGCCAGCCGCCACCCGTTCCGTCCTTTT
AAGCTTATCCCCCGAATAACACAGTCGCCTCCTCCGGATCAACCGACACGGTCAACAAACGTCACTTTCTAACAC
GCTTCGCGGACCTGGACGCCGCGAAGTCGAGGCTCACGATGGAATCTGCCAATTCCTTCGCCGGGCCCGTCTCAT
ACCGTCTGGCCCACGTTGCCCGGAATGCCTACGACTACCCGATGGCCGTCCTCCAAGGACAGCCGACGGGCCACC
CCTCGCTACCTCACCTGTGTCTCCTCGTCTTCGAAGCCGTCCTCGAGGTCGTCTGCGTCAGTCTTCCGGGCTACA
TCATCGCCCGGCTTGGCCACTTTGATGCAGACAAGCAGAAATTTCTGGCCAACCTCAATGTCATGTTGTTTACCC
CATGCCTGAGTAAGGTCTCTTTGCCATCCCCGTCGTCCCACCGTCGCTGACCCATGCCTCGACAGTCTTTACGAA
ACTGGCATCCCAACTAAACGCCGAGAAGCTGACCGAGCTCGCCATTATCCCCGCCATCTTTGTCCTCCAGACCGT
GATATCGTGGATTGTCTCCACCCTGATGGCCAGGGCCTTTCGATTCAACCGACGAGCCTCCAACTTCGTCACTGC
CATGGGTGTCTTCGGCAACTCGAATTCTCTACCCATCTCTCTCGTCCTCTCCCTTTCACAGACCATCAAGGGGCT
CCACTGGGATCGCATTGCAGGGGATAACGACGATGAAGTCGCCGCCCGAGGCATCCTCTATCTCCTCATATTTCA
GCAACTTGGCCAGCTGGTCCGATGGAGCTGGGGGTACCATGTGCTGCTTGCCCCCAAGGACAAATACCCCGAGTA
CCAGCAACAAATTGTCGAAGAGGGCGAGGGCCGCTACGGCGAGGCCCACAGCGAGCAGGAAACCCGACGGCTTAT
CGACGGCTTCGACGACGGAGAGACTGAAGACGACGACGAGCGCCATAGTGTCGACTCTCGCACGTATGTGCCTGA
CGGCCAGACCCCGCTTGCCGGCACCTCGAGGACTTCGGCCGACTCGAGCGACGACGAGTCCGCACCCAAGAAGCT
GCAGCATCCCAAGTGCGCCCCTCGAGCCGAAATTGCTCCCAGGAGCGTGCCCCATACTCTGGCCTTTCCCCGGGT
CGGCAGCAGCGGCGACCGCAGCCCGCCTCGCACCAGGTCCGACGGCATCTGGGCTTCGCACAAGGCGTCGGCCGC
CAACGGGTTTCGTTCTCTGCAAGCCAGGACATCTCGCTGCCTGGATAGCCTCGGCAAGAGGATACCGGACCCGGT
CCGTGTACTCCTGTCAGTCCTGAGGACGGCCTCGAGAAAGACGGCGTATTTCATCTGGGAGTTTATGAACCCGCC
GCTGTGGGCGATGCTCATTGCCGTCACGGTTGCGTCGATTCCTGCGCTTCAGAAGCTCTTCTTCGAGGAGGAATC
GTTCATCAACAACAGCGTGACGAGTGCCGTCAAGTCGAGCGGCGGCGTTGCCGTTCCCCTGATCCTGGTCGTTCT
GGGCGCCAACCTTGCGAGAAACACGATGGCGCGGGACGACAGCCACGACCCCGAAGAGGAGCAGGTCGGAACCAA
GCTCCTGGTGGCGGCCTTGTTGAGCCGGATGGTCCTACCGACCGTCATCATGGCTCCGATCCTGGCTCTCATGGC
AAAGTACTTGCCCGTCAGCATTCTTGACGATCCCATCTTCATCGTCGTCTGCTTCCTACTGACCGGTGCCCCGAG
CGCGTTGCAGCTGGCTCAGATCTGCCAGATCAACGCCGTGTACGAGAAGACGATGGGCCGGGTGCTCTTCCAGAG
CTACGTCATATGGTGCGTTCCTCCCCGCTGGCCGTGTGCTGAAGATGGCTAACGAGCGCAACATGGCAGGATTCT
ACCTTCCACGTTGATCCTTGTCATGATGGCTCTCGAAGTTGTACAGTGGGCGGCTGCGCCATGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail