Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|6452
Gene name
Locationscaffold_565:5689..7853
Strand+
Gene length (bp)2164
Transcript length (bp)1866
Coding sequence length (bp)1863
Protein length (aa) 621

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF03547 Mem_trans Membrane transport protein 3.6E-45 125 606

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|P38355|YB8B_YEAST Uncharacterized transporter YBR287W OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YBR287W PE=1 SV=1 124 261 2.0E-42
sp|P38355|YB8B_YEAST Uncharacterized transporter YBR287W OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YBR287W PE=1 SV=1 442 618 4.0E-40
sp|O14197|YDQ4_SCHPO Uncharacterized transporter C5D6.04 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC5D6.04 PE=3 SV=1 126 314 2.0E-38
sp|O14197|YDQ4_SCHPO Uncharacterized transporter C5D6.04 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC5D6.04 PE=3 SV=1 430 617 1.0E-33

GO

GO Term Description Terminal node
GO:0016021 integral component of membrane Yes
GO:0055085 transmembrane transport Yes
GO:0009987 cellular process No
GO:0051234 establishment of localization No
GO:0006810 transport No
GO:0110165 cellular anatomical entity No
GO:0031224 intrinsic component of membrane No
GO:0005575 cellular_component No
GO:0051179 localization No
GO:0008150 biological_process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 33 0.45

Transmembrane Domains

Domain # Start End Length
1 128 150 22
2 160 182 22
3 436 458 22
4 478 500 22
5 521 543 22
6 556 575 19
7 596 618 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|6452
MPAPSISPSLRDKDILQNTALALRAIVSSSAADDALRLRLLRINRHGQQTSLSNTLRGPGRREVEAHDGICQFLR
RARLIPSGPRCPECLRLPDGRPPRTADGPPLATSPVSPRLRSRPRGRLHKQKFLANLNVMLFTPCLIFTKLASQL
NAEKLTELAIIPAIFVLQTVISWIVSTLMARAFRFNRRASNFVTAMGVFGNSNSLPISLVLSLSQTIKGLHWDRI
AGDNDDEVAARGILYLLIFQQLGQLVRWSWGYHVLLAPKDKYPEYQQQIVEEGEGRYGEAHSEQETRRLIDGFDD
GETEDDDERHSVDSRTYVPDGQTPLAGTSRTSADSSDDESAPKKLQHPKCAPRAEIAPRSVPHTLAFPRVGSSGD
RSPPRTRSDGIWASHKASAANGFRSLQARTSRCLDSLGKRIPDPVRVLLSVLRTASRKTAYFIWEFMNPPLWAML
IAVTVASIPALQKLFFEEESFINNSVTSAVKSSGGVAVPLILVVLGANLARNTMARDDSHDPEEEQVGTKLLVAA
LLSRMVLPTVIMAPILALMAKYLPVSILDDPIFIVVCFLLTGAPSALQLAQICQINAVYEKTMGRVLFQSYVIWI
LPSTLILVMMALEVVQWAAAP
Coding >Ophio5|6452
ATGCCTGCGCCCTCCATCTCACCATCGCTGCGCGATAAGGATATTTTGCAGAATACGGCCTTGGCGCTGCGCGCT
ATTGTCTCCTCGTCTGCGGCCGATGACGCATTGAGACTTCGCCTCCTCCGGATCAACCGACACGGTCAACAAACG
TCACTTTCTAACACGCTTCGCGGACCTGGACGCCGCGAAGTCGAGGCTCACGATGGAATCTGCCAATTCCTTCGC
CGGGCCCGTCTCATACCGTCTGGCCCACGTTGCCCGGAATGCCTACGACTACCCGATGGCCGTCCTCCAAGGACA
GCCGACGGGCCACCCCTCGCTACCTCACCTGTGTCTCCTCGTCTTCGAAGCCGTCCTCGAGGTCGTCTGCACAAG
CAGAAATTTCTGGCCAACCTCAATGTCATGTTGTTTACCCCATGCCTGATCTTTACGAAACTGGCATCCCAACTA
AACGCCGAGAAGCTGACCGAGCTCGCCATTATCCCCGCCATCTTTGTCCTCCAGACCGTGATATCGTGGATTGTC
TCCACCCTGATGGCCAGGGCCTTTCGATTCAACCGACGAGCCTCCAACTTCGTCACTGCCATGGGTGTCTTCGGC
AACTCGAATTCTCTACCCATCTCTCTCGTCCTCTCCCTTTCACAGACCATCAAGGGGCTCCACTGGGATCGCATT
GCAGGGGATAACGACGATGAAGTCGCCGCCCGAGGCATCCTCTATCTCCTCATATTTCAGCAACTTGGCCAGCTG
GTCCGATGGAGCTGGGGGTACCATGTGCTGCTTGCCCCCAAGGACAAATACCCCGAGTACCAGCAACAAATTGTC
GAAGAGGGCGAGGGCCGCTACGGCGAGGCCCACAGCGAGCAGGAAACCCGACGGCTTATCGACGGCTTCGACGAC
GGAGAGACTGAAGACGACGACGAGCGCCATAGTGTCGACTCTCGCACGTATGTGCCTGACGGCCAGACCCCGCTT
GCCGGCACCTCGAGGACTTCGGCCGACTCGAGCGACGACGAGTCCGCACCCAAGAAGCTGCAGCATCCCAAGTGC
GCCCCTCGAGCCGAAATTGCTCCCAGGAGCGTGCCCCATACTCTGGCCTTTCCCCGGGTCGGCAGCAGCGGCGAC
CGCAGCCCGCCTCGCACCAGGTCCGACGGCATCTGGGCTTCGCACAAGGCGTCGGCCGCCAACGGGTTTCGTTCT
CTGCAAGCCAGGACATCTCGCTGCCTGGATAGCCTCGGCAAGAGGATACCGGACCCGGTCCGTGTACTCCTGTCA
GTCCTGAGGACGGCCTCGAGAAAGACGGCGTATTTCATCTGGGAGTTTATGAACCCGCCGCTGTGGGCGATGCTC
ATTGCCGTCACGGTTGCGTCGATTCCTGCGCTTCAGAAGCTCTTCTTCGAGGAGGAATCGTTCATCAACAACAGC
GTGACGAGTGCCGTCAAGTCGAGCGGCGGCGTTGCCGTTCCCCTGATCCTGGTCGTTCTGGGCGCCAACCTTGCG
AGAAACACGATGGCGCGGGACGACAGCCACGACCCCGAAGAGGAGCAGGTCGGAACCAAGCTCCTGGTGGCGGCC
TTGTTGAGCCGGATGGTCCTACCGACCGTCATCATGGCTCCGATCCTGGCTCTCATGGCAAAGTACTTGCCCGTC
AGCATTCTTGACGATCCCATCTTCATCGTCGTCTGCTTCCTACTGACCGGTGCCCCGAGCGCGTTGCAGCTGGCT
CAGATCTGCCAGATCAACGCCGTGTACGAGAAGACGATGGGCCGGGTGCTCTTCCAGAGCTACGTCATATGGATT
CTACCTTCCACGTTGATCCTTGTCATGATGGCTCTCGAAGTTGTACAGTGGGCGGCTGCGCCA
Transcript >Ophio5|6452
ATGCCTGCGCCCTCCATCTCACCATCGCTGCGCGATAAGGATATTTTGCAGAATACGGCCTTGGCGCTGCGCGCT
ATTGTCTCCTCGTCTGCGGCCGATGACGCATTGAGACTTCGCCTCCTCCGGATCAACCGACACGGTCAACAAACG
TCACTTTCTAACACGCTTCGCGGACCTGGACGCCGCGAAGTCGAGGCTCACGATGGAATCTGCCAATTCCTTCGC
CGGGCCCGTCTCATACCGTCTGGCCCACGTTGCCCGGAATGCCTACGACTACCCGATGGCCGTCCTCCAAGGACA
GCCGACGGGCCACCCCTCGCTACCTCACCTGTGTCTCCTCGTCTTCGAAGCCGTCCTCGAGGTCGTCTGCACAAG
CAGAAATTTCTGGCCAACCTCAATGTCATGTTGTTTACCCCATGCCTGATCTTTACGAAACTGGCATCCCAACTA
AACGCCGAGAAGCTGACCGAGCTCGCCATTATCCCCGCCATCTTTGTCCTCCAGACCGTGATATCGTGGATTGTC
TCCACCCTGATGGCCAGGGCCTTTCGATTCAACCGACGAGCCTCCAACTTCGTCACTGCCATGGGTGTCTTCGGC
AACTCGAATTCTCTACCCATCTCTCTCGTCCTCTCCCTTTCACAGACCATCAAGGGGCTCCACTGGGATCGCATT
GCAGGGGATAACGACGATGAAGTCGCCGCCCGAGGCATCCTCTATCTCCTCATATTTCAGCAACTTGGCCAGCTG
GTCCGATGGAGCTGGGGGTACCATGTGCTGCTTGCCCCCAAGGACAAATACCCCGAGTACCAGCAACAAATTGTC
GAAGAGGGCGAGGGCCGCTACGGCGAGGCCCACAGCGAGCAGGAAACCCGACGGCTTATCGACGGCTTCGACGAC
GGAGAGACTGAAGACGACGACGAGCGCCATAGTGTCGACTCTCGCACGTATGTGCCTGACGGCCAGACCCCGCTT
GCCGGCACCTCGAGGACTTCGGCCGACTCGAGCGACGACGAGTCCGCACCCAAGAAGCTGCAGCATCCCAAGTGC
GCCCCTCGAGCCGAAATTGCTCCCAGGAGCGTGCCCCATACTCTGGCCTTTCCCCGGGTCGGCAGCAGCGGCGAC
CGCAGCCCGCCTCGCACCAGGTCCGACGGCATCTGGGCTTCGCACAAGGCGTCGGCCGCCAACGGGTTTCGTTCT
CTGCAAGCCAGGACATCTCGCTGCCTGGATAGCCTCGGCAAGAGGATACCGGACCCGGTCCGTGTACTCCTGTCA
GTCCTGAGGACGGCCTCGAGAAAGACGGCGTATTTCATCTGGGAGTTTATGAACCCGCCGCTGTGGGCGATGCTC
ATTGCCGTCACGGTTGCGTCGATTCCTGCGCTTCAGAAGCTCTTCTTCGAGGAGGAATCGTTCATCAACAACAGC
GTGACGAGTGCCGTCAAGTCGAGCGGCGGCGTTGCCGTTCCCCTGATCCTGGTCGTTCTGGGCGCCAACCTTGCG
AGAAACACGATGGCGCGGGACGACAGCCACGACCCCGAAGAGGAGCAGGTCGGAACCAAGCTCCTGGTGGCGGCC
TTGTTGAGCCGGATGGTCCTACCGACCGTCATCATGGCTCCGATCCTGGCTCTCATGGCAAAGTACTTGCCCGTC
AGCATTCTTGACGATCCCATCTTCATCGTCGTCTGCTTCCTACTGACCGGTGCCCCGAGCGCGTTGCAGCTGGCT
CAGATCTGCCAGATCAACGCCGTGTACGAGAAGACGATGGGCCGGGTGCTCTTCCAGAGCTACGTCATATGGATT
CTACCTTCCACGTTGATCCTTGTCATGATGGCTCTCGAAGTTGTACAGTGGGCGGCTGCGCCATGA
Gene >Ophio5|6452
ATGCCTGCGCCCTCCATCTCACCATCGCTGCGCGATAAGGATATTTTGCGTGCCTCCCGTCCCGCTTTGCCCATT
TTCCCTCTCCTCCCACCTCACATCAAGCGCCTCTCACCCCCTCGTAGAGAATACGGCCTTGGCGCTGCGCGCTAT
TGTCTCCTCGTCTGCGGCCGATGACGCATTGAGACTGTCCGTTCGCGCGCCAGCCGCCACCCGTTCCGTCCTTTT
AAGCTTATCCCCCGAATAACACAGTCGCCTCCTCCGGATCAACCGACACGGTCAACAAACGTCACTTTCTAACAC
GCTTCGCGGACCTGGACGCCGCGAAGTCGAGGCTCACGATGGAATCTGCCAATTCCTTCGCCGGGCCCGTCTCAT
ACCGTCTGGCCCACGTTGCCCGGAATGCCTACGACTACCCGATGGCCGTCCTCCAAGGACAGCCGACGGGCCACC
CCTCGCTACCTCACCTGTGTCTCCTCGTCTTCGAAGCCGTCCTCGAGGTCGTCTGCGTCAGTCTTCCGGGCTACA
TCATCGCCCGGCTTGGCCACTTTGATGCAGACAAGCAGAAATTTCTGGCCAACCTCAATGTCATGTTGTTTACCC
CATGCCTGAGTAAGGTCTCTTTGCCATCCCCGTCGTCCCACCGTCGCTGACCCATGCCTCGACAGTCTTTACGAA
ACTGGCATCCCAACTAAACGCCGAGAAGCTGACCGAGCTCGCCATTATCCCCGCCATCTTTGTCCTCCAGACCGT
GATATCGTGGATTGTCTCCACCCTGATGGCCAGGGCCTTTCGATTCAACCGACGAGCCTCCAACTTCGTCACTGC
CATGGGTGTCTTCGGCAACTCGAATTCTCTACCCATCTCTCTCGTCCTCTCCCTTTCACAGACCATCAAGGGGCT
CCACTGGGATCGCATTGCAGGGGATAACGACGATGAAGTCGCCGCCCGAGGCATCCTCTATCTCCTCATATTTCA
GCAACTTGGCCAGCTGGTCCGATGGAGCTGGGGGTACCATGTGCTGCTTGCCCCCAAGGACAAATACCCCGAGTA
CCAGCAACAAATTGTCGAAGAGGGCGAGGGCCGCTACGGCGAGGCCCACAGCGAGCAGGAAACCCGACGGCTTAT
CGACGGCTTCGACGACGGAGAGACTGAAGACGACGACGAGCGCCATAGTGTCGACTCTCGCACGTATGTGCCTGA
CGGCCAGACCCCGCTTGCCGGCACCTCGAGGACTTCGGCCGACTCGAGCGACGACGAGTCCGCACCCAAGAAGCT
GCAGCATCCCAAGTGCGCCCCTCGAGCCGAAATTGCTCCCAGGAGCGTGCCCCATACTCTGGCCTTTCCCCGGGT
CGGCAGCAGCGGCGACCGCAGCCCGCCTCGCACCAGGTCCGACGGCATCTGGGCTTCGCACAAGGCGTCGGCCGC
CAACGGGTTTCGTTCTCTGCAAGCCAGGACATCTCGCTGCCTGGATAGCCTCGGCAAGAGGATACCGGACCCGGT
CCGTGTACTCCTGTCAGTCCTGAGGACGGCCTCGAGAAAGACGGCGTATTTCATCTGGGAGTTTATGAACCCGCC
GCTGTGGGCGATGCTCATTGCCGTCACGGTTGCGTCGATTCCTGCGCTTCAGAAGCTCTTCTTCGAGGAGGAATC
GTTCATCAACAACAGCGTGACGAGTGCCGTCAAGTCGAGCGGCGGCGTTGCCGTTCCCCTGATCCTGGTCGTTCT
GGGCGCCAACCTTGCGAGAAACACGATGGCGCGGGACGACAGCCACGACCCCGAAGAGGAGCAGGTCGGAACCAA
GCTCCTGGTGGCGGCCTTGTTGAGCCGGATGGTCCTACCGACCGTCATCATGGCTCCGATCCTGGCTCTCATGGC
AAAGTACTTGCCCGTCAGCATTCTTGACGATCCCATCTTCATCGTCGTCTGCTTCCTACTGACCGGTGCCCCGAG
CGCGTTGCAGCTGGCTCAGATCTGCCAGATCAACGCCGTGTACGAGAAGACGATGGGCCGGGTGCTCTTCCAGAG
CTACGTCATATGGTGCGTTCCTCCCCGCTGGCCGTGTGCTGAAGATGGCTAACGAGCGCAACATGGCAGGATTCT
ACCTTCCACGTTGATCCTTGTCATGATGGCTCTCGAAGTTGTACAGTGGGCGGCTGCGCCATGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail