Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|6449
Gene name
Locationscaffold_564:11833..12751
Strand-
Gene length (bp)918
Transcript length (bp)918
Coding sequence length (bp)915
Protein length (aa) 305

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P30589|CHS2_NEUCR Chitin synthase 2 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=chs-2 PE=3 SV=4 4 285 4.0E-142
sp|P30584|CHSA_EMENI Chitin synthase A OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=chsA PE=3 SV=2 1 279 1.0E-115
sp|P30600|CHS1_EXODE Chitin synthase 1 OS=Exophiala dermatitidis GN=CHS1 PE=3 SV=2 1 276 2.0E-112
sp|Q92444|CHS2_PARBR Chitin synthase 2 OS=Paracoccidioides brasiliensis GN=CHS2 PE=3 SV=2 1 277 3.0E-107
sp|P87073|CHS1_PHYB8 Chitin synthase 1 OS=Phycomyces blakesleeanus (strain ATCC 8743b / FGSC 10004 / NBRC 33097 / NRRL 1555) GN=chs1 PE=3 SV=1 1 266 3.0E-66
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P30589|CHS2_NEUCR Chitin synthase 2 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=chs-2 PE=3 SV=4 4 285 4.0E-142
sp|P30584|CHSA_EMENI Chitin synthase A OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=chsA PE=3 SV=2 1 279 1.0E-115
sp|P30600|CHS1_EXODE Chitin synthase 1 OS=Exophiala dermatitidis GN=CHS1 PE=3 SV=2 1 276 2.0E-112
sp|Q92444|CHS2_PARBR Chitin synthase 2 OS=Paracoccidioides brasiliensis GN=CHS2 PE=3 SV=2 1 277 3.0E-107
sp|P87073|CHS1_PHYB8 Chitin synthase 1 OS=Phycomyces blakesleeanus (strain ATCC 8743b / FGSC 10004 / NBRC 33097 / NRRL 1555) GN=chs1 PE=3 SV=1 1 266 3.0E-66
sp|P14180|CHS2_YEAST Chitin synthase 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CHS2 PE=1 SV=1 2 278 5.0E-65
sp|P30595|CHS2_RHIOL Chitin synthase 2 OS=Rhizopus oligosporus GN=CHS2 PE=3 SV=1 2 266 2.0E-59
sp|P23316|CHS1_CANAX Chitin synthase 1 OS=Candida albicans GN=CHS1 PE=2 SV=2 2 276 3.0E-58
sp|P30601|CHS2_EXODE Chitin synthase 2 OS=Exophiala dermatitidis GN=CHS2 PE=3 SV=2 2 271 1.0E-56
sp|P30597|CHS1_SCHPO Chitin synthase 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=chs1 PE=3 SV=2 2 257 1.0E-55
sp|Q12564|CHSA_AMPQU Chitin synthase A OS=Ampelomyces quisqualis GN=CHSA PE=3 SV=1 2 270 2.0E-52
sp|Q99127|CHS4_USTMA Chitin synthase 4 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=CHS4 PE=3 SV=2 8 263 8.0E-52
sp|P30594|CHS1_RHIOL Chitin synthase 1 OS=Rhizopus oligosporus GN=CHS1 PE=3 SV=1 2 266 2.0E-51
sp|P30583|CHSC_EMENI Chitin synthase C OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=chsC PE=3 SV=3 2 266 6.0E-51
sp|Q99126|CHS3_USTMA Chitin synthase 3 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=CHS3 PE=3 SV=2 2 268 6.0E-50
sp|P30572|CHS2_CANAX Chitin synthase 2 OS=Candida albicans GN=CHS2 PE=2 SV=2 2 257 2.0E-46
sp|P30588|CHS3_NEUCR Chitin synthase 3 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=chs-3 PE=3 SV=2 1 266 4.0E-46
sp|Q12632|CHS1_MUCCL Chitin synthase 1 OS=Mucor circinelloides f. lusitanicus GN=CHS1 PE=3 SV=1 2 266 7.0E-46
sp|P30602|CHS3_EXODE Chitin synthase 3 OS=Exophiala dermatitidis GN=CHS3 PE=3 SV=2 3 226 4.0E-45
sp|Q00757|CHSB_EMENI Chitin synthase B OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=chsB PE=2 SV=2 4 261 4.0E-43
sp|P54267|CHSG_ASPFU Chitin synthase G OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=chsG PE=2 SV=2 4 261 2.0E-42
sp|P30598|CHS1_USTMA Chitin synthase 1 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=CHS1 PE=3 SV=3 10 257 1.0E-41
sp|P08004|CHS1_YEAST Chitin synthase 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CHS1 PE=1 SV=2 3 264 2.0E-40
sp|P29070|CHS1_NEUCR Chitin synthase 1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=chs-1 PE=3 SV=2 8 257 4.0E-38
sp|P30599|CHS2_USTMA Chitin synthase 2 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=CHS2 PE=3 SV=2 1 261 1.0E-35
sp|Q92197|CHSC_ASPFU Chitin synthase C OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=chsC PE=3 SV=2 8 261 5.0E-35
sp|O74756|CHS2_SCHPO Chitin synthase-like protein 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=chs2 PE=3 SV=1 5 272 2.0E-34
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 25 0.5

Transmembrane Domains

Domain # Start End Length
1 7 26 19
2 36 58 22
3 78 100 22
4 110 129 19
5 211 230 19
6 245 267 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|6449
MGAVIFTILRYVCVLLVATQFVLSLGNRPQGARRLYLTSMVLYGVIMLYTSFACIYIIVRQLTSTQRDSFLHMGN
NVFTNLVVSMASTIGLYFIMSFLYLEPWHMFTSSLQYFLLLPSYICTLQVYAFCNTHDVTWGTKGDNVLKTDLGT
AVGHAGGQTVELDMPSEQLDIDSGYDEALRNLRDRLAVPPAPVAEAQLQEDYYKSVRTYMVVSWMIANGILAMAV
SDVYSSRGLGDNMYLRFILWSVAALAIFRALGSTAFAVINVVNVVVEGRLRLSVKVPSWLGGLGGRLSETVSSVG
SKLKR
Coding >Ophio5|6449
ATGGGCGCCGTCATCTTTACCATCCTCCGCTACGTCTGTGTCCTCCTCGTCGCTACCCAGTTCGTCCTCTCGCTC
GGAAATCGGCCTCAGGGCGCTCGGAGGCTTTACCTCACCAGCATGGTTCTCTACGGCGTCATCATGCTCTACACT
TCCTTTGCCTGCATCTACATCATCGTCCGCCAACTCACCTCGACTCAGCGTGACTCGTTTCTGCACATGGGCAAT
AACGTCTTCACCAACCTCGTCGTCTCCATGGCCTCCACCATCGGCCTCTACTTCATCATGTCCTTTCTCTACCTC
GAGCCCTGGCACATGTTCACCTCGTCTCTGCAATATTTCCTCCTCTTGCCGAGCTACATCTGCACCCTTCAGGTC
TACGCCTTTTGCAATACCCACGACGTCACCTGGGGCACAAAGGGCGACAACGTGCTCAAGACGGACCTCGGCACC
GCCGTCGGCCACGCCGGCGGCCAGACGGTCGAGCTCGACATGCCCAGCGAGCAGCTCGACATCGACAGCGGCTAC
GACGAGGCCCTCCGCAACCTGCGCGACCGCCTGGCCGTTCCCCCCGCGCCCGTGGCCGAGGCCCAGCTTCAGGAG
GACTACTACAAGAGCGTGCGGACCTACATGGTCGTCTCGTGGATGATTGCCAACGGGATCCTCGCCATGGCCGTC
TCCGACGTCTATAGTAGCCGCGGTCTCGGCGACAACATGTATCTGCGCTTCATCCTCTGGAGCGTCGCCGCCCTC
GCCATTTTCCGCGCCCTCGGCTCCACCGCCTTCGCCGTCATCAACGTCGTCAACGTCGTCGTCGAGGGTCGTCTC
AGGCTGTCCGTCAAGGTGCCCAGCTGGCTCGGCGGCTTGGGCGGTCGATTGAGCGAGACGGTCAGCAGTGTTGGG
AGCAAGCTGAAGCGG
Transcript >Ophio5|6449
ATGGGCGCCGTCATCTTTACCATCCTCCGCTACGTCTGTGTCCTCCTCGTCGCTACCCAGTTCGTCCTCTCGCTC
GGAAATCGGCCTCAGGGCGCTCGGAGGCTTTACCTCACCAGCATGGTTCTCTACGGCGTCATCATGCTCTACACT
TCCTTTGCCTGCATCTACATCATCGTCCGCCAACTCACCTCGACTCAGCGTGACTCGTTTCTGCACATGGGCAAT
AACGTCTTCACCAACCTCGTCGTCTCCATGGCCTCCACCATCGGCCTCTACTTCATCATGTCCTTTCTCTACCTC
GAGCCCTGGCACATGTTCACCTCGTCTCTGCAATATTTCCTCCTCTTGCCGAGCTACATCTGCACCCTTCAGGTC
TACGCCTTTTGCAATACCCACGACGTCACCTGGGGCACAAAGGGCGACAACGTGCTCAAGACGGACCTCGGCACC
GCCGTCGGCCACGCCGGCGGCCAGACGGTCGAGCTCGACATGCCCAGCGAGCAGCTCGACATCGACAGCGGCTAC
GACGAGGCCCTCCGCAACCTGCGCGACCGCCTGGCCGTTCCCCCCGCGCCCGTGGCCGAGGCCCAGCTTCAGGAG
GACTACTACAAGAGCGTGCGGACCTACATGGTCGTCTCGTGGATGATTGCCAACGGGATCCTCGCCATGGCCGTC
TCCGACGTCTATAGTAGCCGCGGTCTCGGCGACAACATGTATCTGCGCTTCATCCTCTGGAGCGTCGCCGCCCTC
GCCATTTTCCGCGCCCTCGGCTCCACCGCCTTCGCCGTCATCAACGTCGTCAACGTCGTCGTCGAGGGTCGTCTC
AGGCTGTCCGTCAAGGTGCCCAGCTGGCTCGGCGGCTTGGGCGGTCGATTGAGCGAGACGGTCAGCAGTGTTGGG
AGCAAGCTGAAGCGGTAG
Gene >Ophio5|6449
ATGGGCGCCGTCATCTTTACCATCCTCCGCTACGTCTGTGTCCTCCTCGTCGCTACCCAGTTCGTCCTCTCGCTC
GGAAATCGGCCTCAGGGCGCTCGGAGGCTTTACCTCACCAGCATGGTTCTCTACGGCGTCATCATGCTCTACACT
TCCTTTGCCTGCATCTACATCATCGTCCGCCAACTCACCTCGACTCAGCGTGACTCGTTTCTGCACATGGGCAAT
AACGTCTTCACCAACCTCGTCGTCTCCATGGCCTCCACCATCGGCCTCTACTTCATCATGTCCTTTCTCTACCTC
GAGCCCTGGCACATGTTCACCTCGTCTCTGCAATATTTCCTCCTCTTGCCGAGCTACATCTGCACCCTTCAGGTC
TACGCCTTTTGCAATACCCACGACGTCACCTGGGGCACAAAGGGCGACAACGTGCTCAAGACGGACCTCGGCACC
GCCGTCGGCCACGCCGGCGGCCAGACGGTCGAGCTCGACATGCCCAGCGAGCAGCTCGACATCGACAGCGGCTAC
GACGAGGCCCTCCGCAACCTGCGCGACCGCCTGGCCGTTCCCCCCGCGCCCGTGGCCGAGGCCCAGCTTCAGGAG
GACTACTACAAGAGCGTGCGGACCTACATGGTCGTCTCGTGGATGATTGCCAACGGGATCCTCGCCATGGCCGTC
TCCGACGTCTATAGTAGCCGCGGTCTCGGCGACAACATGTATCTGCGCTTCATCCTCTGGAGCGTCGCCGCCCTC
GCCATTTTCCGCGCCCTCGGCTCCACCGCCTTCGCCGTCATCAACGTCGTCAACGTCGTCGTCGAGGGTCGTCTC
AGGCTGTCCGTCAAGGTGCCCAGCTGGCTCGGCGGCTTGGGCGGTCGATTGAGCGAGACGGTCAGCAGTGTTGGG
AGCAAGCTGAAGCGGTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail