Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|6447
Gene name
Locationscaffold_564:5206..5787
Strand+
Gene length (bp)581
Transcript length (bp)468
Coding sequence length (bp)465
Protein length (aa) 155

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF08552 Kei1 Inositolphosphorylceramide synthase subunit Kei1 2.5E-43 16 121

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|O13994|KEI1_SCHPO Inositol phoshorylceramide synthase regulatory subunit kei1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=kei1 PE=3 SV=1 15 130 1.0E-11
sp|Q06346|KEI1_YEAST Inositol phosphorylceramide synthase regulatory subunit KEI1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=KEI1 PE=1 SV=2 14 113 8.0E-06

GO

GO Term Description Terminal node
GO:0006673 inositol phosphoceramide metabolic process Yes
GO:0070917 inositol phosphoceramide synthase regulator activity Yes
GO:0044255 cellular lipid metabolic process No
GO:0008150 biological_process No
GO:1901564 organonitrogen compound metabolic process No
GO:0006796 phosphate-containing compound metabolic process No
GO:0044238 primary metabolic process No
GO:0006644 phospholipid metabolic process No
GO:0006665 sphingolipid metabolic process No
GO:0008152 metabolic process No
GO:0044237 cellular metabolic process No
GO:0003674 molecular_function No
GO:0006793 phosphorus metabolic process No
GO:0071704 organic substance metabolic process No
GO:0009987 cellular process No
GO:0098772 molecular function regulator activity No
GO:0030234 enzyme regulator activity No
GO:0006629 lipid metabolic process No
GO:0019637 organophosphate metabolic process No
GO:0006643 membrane lipid metabolic process No
GO:0006807 nitrogen compound metabolic process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 20 0.5

Transmembrane Domains

Domain # Start End Length
1 54 76 22
2 88 110 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
SC16a Pure fungal culture 140.65 71.46 209.84
CcL In ants, during behavior modification 41.74 11.66 71.83
CcD In ants, recently dead 49.80 19.72 79.87

Differential expression

Label1 Label2 Q-value Significant difference
SC16a CcL 0.000535 yes
SC16a CcD 0.000286 yes
CcL CcD 0.637332 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|6447
MTRLTRLLLRIPRPQSLFGVISLQTGTELIALAQVFNKVTGVYGLLAILTGYKLSVLQLSTYIYSIAVLAVVVYL
IPHIRRQSPFECLALAWVYLLDTVINGVYTVAFGLELYLASITVSDIESPPSSSLSSIVAKGLSGLRRESEAPVK
ASILQ
Coding >Ophio5|6447
ATGACAAGATTAACGAGGCTGCTTCTTCGGATACCCCGCCCGCAGAGCCTATTTGGCGTCATCAGCCTCCAGACA
GGCACTGAGCTCATCGCGCTGGCCCAGGTCTTTAACAAGGTCACCGGGGTGTACGGCTTGCTCGCCATTCTCACG
GGCTACAAGTTGTCGGTGCTGCAGCTGTCGACATATATCTACTCCATCGCCGTTCTCGCCGTCGTCGTCTACCTG
ATCCCGCACATCCGACGGCAAAGCCCGTTTGAGTGTCTCGCCCTGGCTTGGGTGTACCTCCTCGACACGGTCATC
AATGGAGTCTATACGGTCGCCTTCGGGCTCGAGCTGTATTTAGCCAGCATCACGGTCAGCGACATAGAGTCGCCG
CCGTCCTCGTCGCTCTCCAGCATCGTCGCCAAGGGTTTGAGCGGATTGCGGCGAGAGAGCGAGGCCCCAGTCAAG
GCGAGTATACTTCAG
Transcript >Ophio5|6447
ATGACAAGATTAACGAGGCTGCTTCTTCGGATACCCCGCCCGCAGAGCCTATTTGGCGTCATCAGCCTCCAGACA
GGCACTGAGCTCATCGCGCTGGCCCAGGTCTTTAACAAGGTCACCGGGGTGTACGGCTTGCTCGCCATTCTCACG
GGCTACAAGTTGTCGGTGCTGCAGCTGTCGACATATATCTACTCCATCGCCGTTCTCGCCGTCGTCGTCTACCTG
ATCCCGCACATCCGACGGCAAAGCCCGTTTGAGTGTCTCGCCCTGGCTTGGGTGTACCTCCTCGACACGGTCATC
AATGGAGTCTATACGGTCGCCTTCGGGCTCGAGCTGTATTTAGCCAGCATCACGGTCAGCGACATAGAGTCGCCG
CCGTCCTCGTCGCTCTCCAGCATCGTCGCCAAGGGTTTGAGCGGATTGCGGCGAGAGAGCGAGGCCCCAGTCAAG
GCGAGTATACTTCAGTAA
Gene >Ophio5|6447
ATGACAAGATTAACGAGGCTGCTTCTTCGGATACCCCGCCCGCAGGTCCGCAGACCCGCATGATGCAGGATGCAG
AGAGTTCGCTGACGCAGTGGACAGAGCCTATTTGGCGTCATCAGCCTCCAGACAGGCACTGAGCTCATCGCGCTG
GCCCAGGTCTTTAACAAGGTCACCGGGGTGTACGGCTTGCTCGCCATTCTCACGGGCTACAAGTTGTCGGTGCTG
CAGCTGTCGACATATATCTACTCCATCGCCGTTCTCGCCGTCGTCGTCTACCTGATCCCGCACATCCGACGGCAA
AGCCCGTTTGAGTGTCTCGCCCTGGCTTGGGTGTACCTCCTCGACACGGTCATCAATGGAGTCTATACGGTCGCC
TTCGGGCTCGAGCTGTATTTAGCCAGCATCACGGTCAGCGACATAGAGTCGCCGCCGTCCTCGTCGCTCTCCAGC
ATCGTCGCCAAGGGTTTGAGCGGATTGCGGCGAGAGAGCGAGGCCCCAGTCAAGGCGGTGGTTCCCCAGGAGACG
GCGACGAGCATGCTCCTGATTGTGGGACTGACGCTTCTCAGAGTATACTTCAGTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail