Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|6425
Gene name
Locationscaffold_560:1198..3410
Strand-
Gene length (bp)2212
Transcript length (bp)1881
Coding sequence length (bp)1878
Protein length (aa) 626

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00620 RhoGAP RhoGAP domain 1.4E-21 526 617
PF00611 FCH Fes/CIP4, and EFC/F-BAR homology domain 3.0E-12 79 151

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P38339|RGD1_YEAST RHO GTPase-activating protein RGD1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RGD1 PE=1 SV=1 67 603 7.0E-54
sp|O94466|RGA7_SCHPO Probable Rho-GTPase-activating protein 7 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rga7 PE=1 SV=1 67 614 5.0E-42
sp|Q6TLK4|RHG27_RAT Rho GTPase-activating protein 27 OS=Rattus norvegicus GN=Arhgap27 PE=1 SV=1 509 614 3.0E-17
sp|Q6ZUM4|RHG27_HUMAN Rho GTPase-activating protein 27 OS=Homo sapiens GN=ARHGAP27 PE=1 SV=3 509 614 3.0E-17
sp|Q9BE31|RHG12_MACFA Rho GTPase-activating protein 12 OS=Macaca fascicularis GN=ARHGAP12 PE=2 SV=1 509 614 3.0E-17
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P38339|RGD1_YEAST RHO GTPase-activating protein RGD1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RGD1 PE=1 SV=1 67 603 7.0E-54
sp|O94466|RGA7_SCHPO Probable Rho-GTPase-activating protein 7 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rga7 PE=1 SV=1 67 614 5.0E-42
sp|Q6TLK4|RHG27_RAT Rho GTPase-activating protein 27 OS=Rattus norvegicus GN=Arhgap27 PE=1 SV=1 509 614 3.0E-17
sp|Q6ZUM4|RHG27_HUMAN Rho GTPase-activating protein 27 OS=Homo sapiens GN=ARHGAP27 PE=1 SV=3 509 614 3.0E-17
sp|Q9BE31|RHG12_MACFA Rho GTPase-activating protein 12 OS=Macaca fascicularis GN=ARHGAP12 PE=2 SV=1 509 614 3.0E-17
sp|A2AB59|RHG27_MOUSE Rho GTPase-activating protein 27 OS=Mus musculus GN=Arhgap27 PE=1 SV=1 509 614 3.0E-17
sp|Q9Z1N3|MYO9A_RAT Unconventional myosin-IXa OS=Rattus norvegicus GN=Myo9a PE=1 SV=1 510 614 4.0E-17
sp|Q8C170|MYO9A_MOUSE Unconventional myosin-IXa OS=Mus musculus GN=Myo9a PE=1 SV=2 510 614 5.0E-17
sp|Q8C0D4|RHG12_MOUSE Rho GTPase-activating protein 12 OS=Mus musculus GN=Arhgap12 PE=1 SV=2 509 614 1.0E-16
sp|B2RTY4|MYO9A_HUMAN Unconventional myosin-IXa OS=Homo sapiens GN=MYO9A PE=1 SV=2 510 614 2.0E-16
sp|Q8IWW6|RHG12_HUMAN Rho GTPase-activating protein 12 OS=Homo sapiens GN=ARHGAP12 PE=1 SV=1 509 614 2.0E-16
sp|A4IF90|RHG15_BOVIN Rho GTPase-activating protein 15 OS=Bos taurus GN=ARHGAP15 PE=2 SV=1 509 614 6.0E-16
sp|Q53QZ3|RHG15_HUMAN Rho GTPase-activating protein 15 OS=Homo sapiens GN=ARHGAP15 PE=1 SV=2 509 614 7.0E-16
sp|Q5SSL4|ABR_MOUSE Active breakpoint cluster region-related protein OS=Mus musculus GN=Abr PE=1 SV=1 509 618 2.0E-15
sp|A6QNS3|ABR_BOVIN Active breakpoint cluster region-related protein OS=Bos taurus GN=ABR PE=2 SV=1 497 618 4.0E-15
sp|Q12979|ABR_HUMAN Active breakpoint cluster region-related protein OS=Homo sapiens GN=ABR PE=2 SV=2 509 618 4.0E-15
sp|A4II46|ABR_XENTR Active breakpoint cluster region-related protein OS=Xenopus tropicalis GN=abr PE=2 SV=1 509 618 2.0E-14
sp|Q8AVG0|ABR_XENLA Active breakpoint cluster region-related protein OS=Xenopus laevis GN=abr PE=2 SV=1 509 618 2.0E-14
sp|Q20498|RRC1_CAEEL GTPase-activating protein rrc-1 OS=Caenorhabditis elegans GN=rrc-1 PE=1 SV=3 508 621 2.0E-14
sp|A8WRJ2|RRC1_CAEBR GTPase-activating protein rrc-1 OS=Caenorhabditis briggsae GN=rrc-1 PE=3 SV=2 508 612 2.0E-14
sp|Q6AYC5|RHG15_RAT Rho GTPase-activating protein 15 OS=Rattus norvegicus GN=Arhgap15 PE=1 SV=1 509 614 2.0E-14
sp|Q15311|RBP1_HUMAN RalA-binding protein 1 OS=Homo sapiens GN=RALBP1 PE=1 SV=3 508 615 3.0E-14
sp|Q811M1|RHG15_MOUSE Rho GTPase-activating protein 15 OS=Mus musculus GN=Arhgap15 PE=1 SV=1 509 614 3.0E-14
sp|P11274|BCR_HUMAN Breakpoint cluster region protein OS=Homo sapiens GN=BCR PE=1 SV=2 509 623 4.0E-14
sp|Q6PAJ1|BCR_MOUSE Breakpoint cluster region protein OS=Mus musculus GN=Bcr PE=1 SV=3 509 623 4.0E-14
sp|Q80XD1|CHIO_MOUSE Beta-chimaerin OS=Mus musculus GN=Chn2 PE=1 SV=2 509 618 4.0E-14
sp|Q5ZMM3|RHG15_CHICK Rho GTPase-activating protein 15 OS=Gallus gallus GN=ARHGAP15 PE=2 SV=1 509 614 7.0E-14
sp|Q03070|CHIO_RAT Beta-chimaerin OS=Rattus norvegicus GN=Chn2 PE=2 SV=1 509 618 8.0E-14
sp|Q9DBZ9|SYDE1_MOUSE Rho GTPase-activating protein SYDE1 OS=Mus musculus GN=Syde1 PE=1 SV=1 509 614 1.0E-13
sp|P52757|CHIO_HUMAN Beta-chimaerin OS=Homo sapiens GN=CHN2 PE=1 SV=2 509 618 1.0E-13
sp|Q7Z6I6|RHG30_HUMAN Rho GTPase-activating protein 30 OS=Homo sapiens GN=ARHGAP30 PE=1 SV=3 503 619 2.0E-13
sp|Q6ZW31|SYDE1_HUMAN Rho GTPase-activating protein SYDE1 OS=Homo sapiens GN=SYDE1 PE=1 SV=1 509 614 2.0E-13
sp|Q62172|RBP1_MOUSE RalA-binding protein 1 OS=Mus musculus GN=Ralbp1 PE=1 SV=4 508 621 2.0E-13
sp|Q17QN0|CHIN_BOVIN N-chimaerin OS=Bos taurus GN=CHN1 PE=2 SV=1 509 617 3.0E-13
sp|Q5VT97|SYDE2_HUMAN Rho GTPase-activating protein SYDE2 OS=Homo sapiens GN=SYDE2 PE=1 SV=2 509 618 3.0E-13
sp|Q62796|RBP1_RAT RalA-binding protein 1 OS=Rattus norvegicus GN=Ralbp1 PE=1 SV=3 497 615 6.0E-13
sp|A6X8Z5|RHG31_MOUSE Rho GTPase-activating protein 31 OS=Mus musculus GN=Arhgap31 PE=1 SV=1 503 616 9.0E-13
sp|P30337|CHIN_RAT N-chimaerin OS=Rattus norvegicus GN=Chn1 PE=1 SV=2 509 617 1.0E-12
sp|Q2M1Z3|RHG31_HUMAN Rho GTPase-activating protein 31 OS=Homo sapiens GN=ARHGAP31 PE=1 SV=2 503 616 1.0E-12
sp|Q640N3|RHG30_MOUSE Rho GTPase-activating protein 30 OS=Mus musculus GN=Arhgap30 PE=1 SV=3 509 619 1.0E-12
sp|Q9VIS1|CDGAP_DROME GTPase-activating protein CdGAPr OS=Drosophila melanogaster GN=CdGAPr PE=1 SV=2 509 614 1.0E-12
sp|P15882|CHIN_HUMAN N-chimaerin OS=Homo sapiens GN=CHN1 PE=1 SV=3 509 615 1.0E-12
sp|Q9PT60|RBP1A_XENLA RalA-binding protein 1-A OS=Xenopus laevis GN=ralbp1-a PE=1 SV=3 508 604 2.0E-12
sp|Q91V57|CHIN_MOUSE N-chimaerin OS=Mus musculus GN=Chn1 PE=1 SV=2 509 615 3.0E-12
sp|Q91Z69|SRGP1_MOUSE SLIT-ROBO Rho GTPase-activating protein 1 OS=Mus musculus GN=Srgap1 PE=1 SV=2 524 614 9.0E-12
sp|Q7Z6B7|SRGP1_HUMAN SLIT-ROBO Rho GTPase-activating protein 1 OS=Homo sapiens GN=SRGAP1 PE=1 SV=1 524 614 1.0E-11
sp|Q13459|MYO9B_HUMAN Unconventional myosin-IXb OS=Homo sapiens GN=MYO9B PE=1 SV=3 490 615 2.0E-11
sp|Q61CA4|SYD1_CAEBR Rho GTPase-activating protein syd-1 OS=Caenorhabditis briggsae GN=syd-1 PE=3 SV=2 509 619 2.0E-11
sp|Q811P8|RHG32_MOUSE Rho GTPase-activating protein 32 OS=Mus musculus GN=Arhgap32 PE=1 SV=2 509 616 3.0E-11
sp|Q54FG5|GACJJ_DICDI Rho GTPase-activating protein gacJJ OS=Dictyostelium discoideum GN=gacJJ PE=3 SV=1 509 616 3.0E-11
sp|Q54SL6|GACQ_DICDI Rho GTPase-activating protein gacQ OS=Dictyostelium discoideum GN=gacQ PE=3 SV=1 509 616 3.0E-11
sp|A7KAX9|RHG32_HUMAN Rho GTPase-activating protein 32 OS=Homo sapiens GN=ARHGAP32 PE=1 SV=1 509 616 3.0E-11
sp|O43295|SRGP3_HUMAN SLIT-ROBO Rho GTPase-activating protein 3 OS=Homo sapiens GN=SRGAP3 PE=1 SV=3 524 614 6.0E-11
sp|Q68EM7|RHG17_HUMAN Rho GTPase-activating protein 17 OS=Homo sapiens GN=ARHGAP17 PE=1 SV=1 501 617 7.0E-11
sp|Q6DFG0|RH21A_XENLA Rho GTPase-activating protein 21-A OS=Xenopus laevis GN=arhgap21-a PE=2 SV=1 525 617 8.0E-11
sp|Q99N37|RHG17_RAT Rho GTPase-activating protein 17 OS=Rattus norvegicus GN=Arhgap17 PE=1 SV=1 501 617 1.0E-10
sp|Q3UIA2|RHG17_MOUSE Rho GTPase-activating protein 17 OS=Mus musculus GN=Arhgap17 PE=1 SV=1 501 617 1.0E-10
sp|Q63358|MYO9B_RAT Unconventional myosin-IXb OS=Rattus norvegicus GN=Myo9b PE=1 SV=1 510 615 1.0E-10
sp|Q9HF75|BEM2_ASHGO GTPase-activating protein BEM2 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=BEM2 PE=3 SV=1 503 612 1.0E-10
sp|O14559|RHG33_HUMAN Rho GTPase-activating protein 33 OS=Homo sapiens GN=ARHGAP33 PE=1 SV=2 509 617 2.0E-10
sp|Q80YF9|RHG33_MOUSE Rho GTPase-activating protein 33 OS=Mus musculus GN=Arhgap33 PE=1 SV=1 509 617 2.0E-10
sp|Q9QY06|MYO9B_MOUSE Unconventional myosin-IXb OS=Mus musculus GN=Myo9b PE=1 SV=2 510 615 2.0E-10
sp|O74360|RGA4_SCHPO Probable Rho-type GTPase-activating protein 4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rga4 PE=1 SV=2 523 618 2.0E-10
sp|P34288|PAC1_CAEEL GTPase-activating protein pac-1 OS=Caenorhabditis elegans GN=pac-1 PE=1 SV=4 525 614 2.0E-10
sp|Q812A2|SRGP3_MOUSE SLIT-ROBO Rho GTPase-activating protein 3 OS=Mus musculus GN=Srgap3 PE=1 SV=1 524 614 3.0E-10
sp|Q71M21|RH21B_XENLA Rho GTPase-activating protein 21-B OS=Xenopus laevis GN=arhgap21-b PE=2 SV=1 525 614 4.0E-10
sp|A2RUV4|RHG21_XENTR Rho GTPase-activating protein 21 OS=Xenopus tropicalis GN=arhgap21 PE=2 SV=1 525 617 4.0E-10
sp|O43182|RHG06_HUMAN Rho GTPase-activating protein 6 OS=Homo sapiens GN=ARHGAP6 PE=1 SV=3 525 612 5.0E-10
sp|Q86NH1|SYD1_CAEEL Rho GTPase-activating protein syd-1 OS=Caenorhabditis elegans GN=syd-1 PE=2 SV=1 509 619 6.0E-10
sp|Q6GPD0|RHG32_XENLA Rho GTPase-activating protein 32 OS=Xenopus laevis GN=arhgap32 PE=2 SV=1 509 616 7.0E-10
sp|Q86I31|GACFF_DICDI Rho GTPase-activating protein gacFF OS=Dictyostelium discoideum GN=gacFF PE=2 SV=1 508 603 8.0E-10
sp|O54834|RHG06_MOUSE Rho GTPase-activating protein 6 OS=Mus musculus GN=Arhgap6 PE=1 SV=3 525 612 9.0E-10
sp|P46941|TG325_CAEEL WW domain-containing protein tag-325 OS=Caenorhabditis elegans GN=tag-325 PE=3 SV=1 508 614 9.0E-10
sp|Q91YM2|RHG35_MOUSE Rho GTPase-activating protein 35 OS=Mus musculus GN=Arhgap35 PE=1 SV=3 510 603 1.0E-09
sp|P81128|RHG35_RAT Rho GTPase-activating protein 35 OS=Rattus norvegicus GN=Arhgap35 PE=1 SV=2 510 603 1.0E-09
sp|P39960|BEM2_YEAST GTPase-activating protein BEM2/IPL2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=BEM2 PE=1 SV=1 509 604 1.0E-09
sp|Q9NRY4|RHG35_HUMAN Rho GTPase-activating protein 35 OS=Homo sapiens GN=ARHGAP35 PE=1 SV=3 510 603 1.0E-09
sp|P97393|RHG05_MOUSE Rho GTPase-activating protein 5 OS=Mus musculus GN=Arhgap5 PE=1 SV=2 510 615 1.0E-09
sp|P83509|RHG35_CANLF Rho GTPase-activating protein 35 OS=Canis lupus familiaris GN=ARHGAP35 PE=2 SV=1 510 603 1.0E-09
sp|Q13017|RHG05_HUMAN Rho GTPase-activating protein 5 OS=Homo sapiens GN=ARHGAP5 PE=1 SV=2 510 615 1.0E-09
sp|Q54TH9|GACY_DICDI Rho GTPase-activating protein gacY OS=Dictyostelium discoideum GN=gacY PE=3 SV=1 502 612 2.0E-09
sp|Q6DFV3|RHG21_MOUSE Rho GTPase-activating protein 21 OS=Mus musculus GN=Arhgap21 PE=1 SV=1 525 614 4.0E-09
sp|Q5T5U3|RHG21_HUMAN Rho GTPase-activating protein 21 OS=Homo sapiens GN=ARHGAP21 PE=1 SV=1 525 614 5.0E-09
sp|Q9P227|RHG23_HUMAN Rho GTPase-activating protein 23 OS=Homo sapiens GN=ARHGAP23 PE=1 SV=2 525 614 7.0E-09
sp|Q9P107|GMIP_HUMAN GEM-interacting protein OS=Homo sapiens GN=GMIP PE=1 SV=2 505 617 7.0E-09
sp|Q69ZH9|RHG23_MOUSE Rho GTPase-activating protein 23 OS=Mus musculus GN=Arhgap23 PE=1 SV=2 525 614 8.0E-09
sp|Q9V9S7|SYDE_DROME Rho GTPase-activating protein 100F OS=Drosophila melanogaster GN=RhoGAP100F PE=1 SV=2 509 604 1.0E-08
sp|Q9BRR9|RHG09_HUMAN Rho GTPase-activating protein 9 OS=Homo sapiens GN=ARHGAP9 PE=1 SV=2 509 597 2.0E-08
sp|Q91Z67|SRGP2_MOUSE SLIT-ROBO Rho GTPase-activating protein 2 OS=Mus musculus GN=Srgap2 PE=1 SV=2 522 616 2.0E-08
sp|Q5TG30|RHG40_HUMAN Rho GTPase-activating protein 40 OS=Homo sapiens GN=ARHGAP40 PE=3 SV=3 500 611 2.0E-08
sp|Q6Y5D8|RHG10_MOUSE Rho GTPase-activating protein 10 OS=Mus musculus GN=Arhgap10 PE=1 SV=2 528 617 3.0E-08
sp|P98171|RHG04_HUMAN Rho GTPase-activating protein 4 OS=Homo sapiens GN=ARHGAP4 PE=1 SV=2 509 603 3.0E-08
sp|Q8BZ05|ARAP2_MOUSE Arf-GAP with Rho-GAP domain, ANK repeat and PH domain-containing protein 2 OS=Mus musculus GN=Arap2 PE=1 SV=2 525 617 3.0E-08
sp|D4A208|SRGP2_RAT SLIT-ROBO Rho GTPase-activating protein 2 OS=Rattus norvegicus GN=Srgap2 PE=1 SV=1 522 616 3.0E-08
sp|Q559A0|GACU_DICDI Rho GTPase-activating protein gacU OS=Dictyostelium discoideum GN=gacU PE=3 SV=1 508 614 3.0E-08
sp|Q8BYW1|RHG25_MOUSE Rho GTPase-activating protein 25 OS=Mus musculus GN=Arhgap25 PE=1 SV=2 525 612 4.0E-08
sp|Q8BL80|RHG22_MOUSE Rho GTPase-activating protein 22 OS=Mus musculus GN=Arhgap22 PE=1 SV=2 526 615 4.0E-08
sp|O75044|SRGP2_HUMAN SLIT-ROBO Rho GTPase-activating protein 2 OS=Homo sapiens GN=SRGAP2 PE=1 SV=2 522 603 4.0E-08
sp|Q6PGG2|GMIP_MOUSE GEM-interacting protein OS=Mus musculus GN=Gmip PE=1 SV=1 505 617 5.0E-08
sp|A1A4S6|RHG10_HUMAN Rho GTPase-activating protein 10 OS=Homo sapiens GN=ARHGAP10 PE=1 SV=1 528 617 5.0E-08
sp|P35688|LRG1_YEAST Rho-GTPase-activating protein LRG1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=LRG1 PE=1 SV=3 509 619 6.0E-08
sp|Q08DP6|RHG10_BOVIN Rho GTPase-activating protein 10 OS=Bos taurus GN=ARHGAP10 PE=2 SV=1 528 617 6.0E-08
sp|Q7Z5H3|RHG22_HUMAN Rho GTPase-activating protein 22 OS=Homo sapiens GN=ARHGAP22 PE=1 SV=1 526 615 7.0E-08
sp|Q5U2Z7|RHG24_RAT Rho GTPase-activating protein 24 OS=Rattus norvegicus GN=Arhgap24 PE=1 SV=2 502 616 9.0E-08
sp|Q8C4V1|RHG24_MOUSE Rho GTPase-activating protein 24 OS=Mus musculus GN=Arhgap24 PE=1 SV=2 502 616 9.0E-08
sp|Q8BN58|RHG28_MOUSE Rho GTPase-activating protein 28 OS=Mus musculus GN=Arhgap28 PE=1 SV=1 509 613 9.0E-08
sp|Q54FF4|GACL_DICDI Rho GTPase-activating protein gacL OS=Dictyostelium discoideum GN=gacL PE=2 SV=1 509 615 9.0E-08
sp|Q17R89|RHG44_HUMAN Rho GTPase-activating protein 44 OS=Homo sapiens GN=ARHGAP44 PE=1 SV=1 508 617 1.0E-07
sp|Q8N264|RHG24_HUMAN Rho GTPase-activating protein 24 OS=Homo sapiens GN=ARHGAP24 PE=1 SV=2 502 615 1.0E-07
sp|Q8WZ64|ARAP2_HUMAN Arf-GAP with Rho-GAP domain, ANK repeat and PH domain-containing protein 2 OS=Homo sapiens GN=ARAP2 PE=1 SV=3 525 617 1.0E-07
sp|F1LQX4|RHG44_RAT Rho GTPase-activating protein 44 OS=Rattus norvegicus GN=Arhgap44 PE=1 SV=2 501 616 1.0E-07
sp|Q5SSM3|RHG44_MOUSE Rho GTPase-activating protein 44 OS=Mus musculus GN=Arhgap44 PE=1 SV=1 501 616 2.0E-07
sp|Q9H0H5|RGAP1_HUMAN Rac GTPase-activating protein 1 OS=Homo sapiens GN=RACGAP1 PE=1 SV=1 494 618 2.0E-07
sp|P42331|RHG25_HUMAN Rho GTPase-activating protein 25 OS=Homo sapiens GN=ARHGAP25 PE=1 SV=2 525 612 2.0E-07
sp|O14526|FCHO1_HUMAN F-BAR domain only protein 1 OS=Homo sapiens GN=FCHO1 PE=1 SV=2 80 299 2.0E-07
sp|B0S6J3|SRGP2_DANRE SLIT-ROBO Rho GTPase-activating protein 2 OS=Danio rerio GN=srgap2 PE=2 SV=1 525 619 3.0E-07
sp|Q9Y3L3|3BP1_HUMAN SH3 domain-binding protein 1 OS=Homo sapiens GN=SH3BP1 PE=1 SV=3 509 616 5.0E-07
sp|Q6PCS4|RHG29_DANRE Rho GTPase-activating protein 29 OS=Danio rerio GN=arhgap29 PE=2 SV=1 507 615 6.0E-07
sp|B9VTT2|RHG07_CANLF Rho GTPase-activating protein 7 OS=Canis lupus familiaris GN=DLC1 PE=2 SV=1 509 612 8.0E-07
sp|Q63744|RHG07_RAT Rho GTPase-activating protein 7 OS=Rattus norvegicus GN=Dlc1 PE=1 SV=3 509 612 8.0E-07
sp|Q96QB1|RHG07_HUMAN Rho GTPase-activating protein 7 OS=Homo sapiens GN=DLC1 PE=1 SV=4 509 612 8.0E-07
sp|Q8R5G7|ARAP3_MOUSE Arf-GAP with Rho-GAP domain, ANK repeat and PH domain-containing protein 3 OS=Mus musculus GN=Arap3 PE=1 SV=3 525 602 1.0E-06
sp|A7E300|RHG07_BOVIN Rho GTPase-activating protein 7 OS=Bos taurus GN=DLC1 PE=2 SV=1 509 612 1.0E-06
sp|Q8WWN8|ARAP3_HUMAN Arf-GAP with Rho-GAP domain, ANK repeat and PH domain-containing protein 3 OS=Homo sapiens GN=ARAP3 PE=1 SV=1 525 602 2.0E-06
sp|O14014|RGA3_SCHPO Probable Rho-type GTPase-activating protein 3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rga3 PE=1 SV=1 504 603 3.0E-06
sp|Q9VTU3|RG68F_DROME Rho GTPase-activating protein 68F OS=Drosophila melanogaster GN=RhoGAP68F PE=1 SV=1 475 609 5.0E-06
sp|Q8K285|FCHO1_MOUSE F-BAR domain only protein 1 OS=Mus musculus GN=Fcho1 PE=1 SV=2 85 299 5.0E-06
sp|Q9R0Z9|RHG07_MOUSE Rho GTPase-activating protein 7 OS=Mus musculus GN=Dlc1 PE=1 SV=2 509 612 6.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0007165 signal transduction Yes
GO:0009987 cellular process No
GO:0050789 regulation of biological process No
GO:0065007 biological regulation No
GO:0050794 regulation of cellular process No
GO:0008150 biological_process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 53 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|6425
MADKRDSSGQDGERTDSLTATAVQPPATSPEKDGDAISSGRQSDDVVVNAPRSPTSPPAFDSALFQQVHQVMASE
LSIPTLLTRLKQSIASAKEFALFLKKRSTFEDDHAQSLKKLCRLTLESSRRPEHRQGSFAQSYEEMVFIHDRMAE
NGLQFANSLHQMYEDLIELAASAERGRKIWKSNGMSAEQKVADLEQAMRKSKAKYDSLADEYDRARTGEGRQGGK
MLGAFKAHKSAAQHEEDLLRKVQAADQTYHGHVNALQQEKSHLLSTARPEAAQALQELIAETDAGVTLQMQKFAA
CNERLLLGNGLIISPYGGQAGSVATQRRSLREAVAAIDNTRDLHVFVAAHHGKIQPKAEIRYERNPLLNPPAQTA
APVSAPLTMNPPGPTLGQTSTPSFSSSVPAAGSRSSTGNLGPVVGSPDPPRPLQPPHARSFSHGTAQNQQQLATK
QPRFGNGATQGPPQLGALPFQGGQPPPSQGPSGSPAQDGRFQSGGPPAYGQGGGASLPVFGVPLSRLYERDSLAV
PLVVHQCIQAVDLYGLAVEGIYRQSGSLNHINKLKAMFDADCQNPALDFRNPESFYHDVNSVTGLLKQFFRDLPD
PLLTMEHHDAFIAAASTSLSLLFFFF
Coding >Ophio5|6425
ATGGCCGACAAGCGCGATTCCTCTGGCCAGGACGGCGAGAGGACCGATAGCCTGACGGCCACTGCAGTTCAGCCC
CCGGCGACGAGCCCGGAAAAGGATGGCGATGCCATCTCCAGCGGCCGCCAGAGCGACGATGTCGTGGTCAATGCG
CCCCGGAGCCCGACCTCTCCGCCTGCCTTTGACAGCGCCCTGTTCCAGCAGGTTCACCAAGTCATGGCCTCCGAG
CTGAGCATCCCGACCCTCTTGACTCGCCTCAAGCAGAGCATTGCCTCGGCCAAGGAGTTCGCCCTCTTCCTCAAA
AAACGGTCCACGTTTGAAGACGACCACGCTCAGAGCCTCAAGAAACTCTGTCGACTAACGCTCGAGAGCTCGCGA
CGCCCCGAGCACCGGCAAGGATCTTTCGCCCAGTCTTACGAAGAAATGGTCTTCATCCATGACCGCATGGCCGAA
AACGGGCTGCAATTCGCCAATTCCCTCCACCAAATGTACGAGGACCTCATCGAGCTGGCGGCCAGCGCCGAGCGC
GGGCGCAAGATCTGGAAGAGCAACGGCATGTCGGCCGAGCAAAAGGTGGCCGACCTCGAGCAAGCCATGCGCAAG
AGCAAGGCCAAATACGACTCGCTGGCCGACGAGTACGACCGCGCCAGGACGGGCGAGGGCAGGCAGGGAGGCAAG
ATGCTGGGCGCCTTCAAGGCGCATAAGTCGGCCGCTCAACACGAGGAAGATTTATTGCGCAAGGTACAGGCCGCC
GATCAAACCTACCACGGCCACGTCAACGCCCTACAGCAGGAAAAGTCCCATCTCTTGTCGACGGCCCGTCCGGAG
GCCGCTCAGGCGCTACAGGAGCTCATCGCCGAGACCGACGCCGGCGTGACGCTGCAGATGCAAAAGTTTGCCGCC
TGCAACGAGAGGCTACTGCTGGGCAACGGCCTGATCATCAGCCCCTACGGCGGGCAGGCGGGCAGCGTCGCGACC
CAGCGTCGAAGCCTGCGCGAAGCCGTGGCCGCCATCGACAACACGAGGGATCTCCACGTCTTCGTCGCCGCTCAC
CACGGCAAGATCCAGCCCAAGGCTGAGATCCGATACGAGCGCAACCCTCTCCTCAACCCCCCGGCTCAGACTGCC
GCCCCCGTGTCGGCGCCGCTGACGATGAATCCGCCCGGCCCGACACTGGGGCAGACGTCGACTCCCTCCTTCTCC
TCGTCGGTGCCCGCAGCCGGCTCACGGAGCAGCACCGGCAATCTCGGGCCTGTCGTCGGCTCGCCCGATCCGCCG
CGTCCACTTCAGCCGCCTCACGCGCGGAGCTTCAGCCACGGCACGGCGCAGAACCAACAGCAGCTCGCGACCAAG
CAGCCGCGCTTCGGCAACGGCGCCACCCAGGGACCGCCCCAGCTGGGGGCCCTGCCCTTCCAGGGTGGCCAGCCG
CCTCCTTCCCAGGGCCCGTCGGGCTCCCCGGCTCAAGACGGCCGCTTCCAATCAGGGGGGCCGCCCGCGTACGGA
CAGGGCGGCGGCGCCTCGCTCCCCGTCTTTGGCGTGCCGCTGAGCCGGCTGTACGAGAGGGATAGCCTGGCGGTG
CCGCTGGTGGTGCATCAGTGCATCCAGGCCGTCGACCTGTACGGGCTGGCCGTCGAGGGCATCTACCGCCAGTCG
GGCTCGCTCAACCACATCAACAAGCTCAAGGCCATGTTCGACGCGGATTGCCAAAACCCGGCTCTCGACTTTCGC
AACCCGGAGAGCTTTTACCACGATGTCAACAGCGTCACGGGGCTGTTGAAGCAGTTCTTCCGCGACCTACCGGAC
CCGTTACTGACGATGGAGCACCACGATGCCTTCATCGCCGCTGCCAGTACGTCTCTGTCACTCCTTTTTTTTTTT
TTT
Transcript >Ophio5|6425
ATGGCCGACAAGCGCGATTCCTCTGGCCAGGACGGCGAGAGGACCGATAGCCTGACGGCCACTGCAGTTCAGCCC
CCGGCGACGAGCCCGGAAAAGGATGGCGATGCCATCTCCAGCGGCCGCCAGAGCGACGATGTCGTGGTCAATGCG
CCCCGGAGCCCGACCTCTCCGCCTGCCTTTGACAGCGCCCTGTTCCAGCAGGTTCACCAAGTCATGGCCTCCGAG
CTGAGCATCCCGACCCTCTTGACTCGCCTCAAGCAGAGCATTGCCTCGGCCAAGGAGTTCGCCCTCTTCCTCAAA
AAACGGTCCACGTTTGAAGACGACCACGCTCAGAGCCTCAAGAAACTCTGTCGACTAACGCTCGAGAGCTCGCGA
CGCCCCGAGCACCGGCAAGGATCTTTCGCCCAGTCTTACGAAGAAATGGTCTTCATCCATGACCGCATGGCCGAA
AACGGGCTGCAATTCGCCAATTCCCTCCACCAAATGTACGAGGACCTCATCGAGCTGGCGGCCAGCGCCGAGCGC
GGGCGCAAGATCTGGAAGAGCAACGGCATGTCGGCCGAGCAAAAGGTGGCCGACCTCGAGCAAGCCATGCGCAAG
AGCAAGGCCAAATACGACTCGCTGGCCGACGAGTACGACCGCGCCAGGACGGGCGAGGGCAGGCAGGGAGGCAAG
ATGCTGGGCGCCTTCAAGGCGCATAAGTCGGCCGCTCAACACGAGGAAGATTTATTGCGCAAGGTACAGGCCGCC
GATCAAACCTACCACGGCCACGTCAACGCCCTACAGCAGGAAAAGTCCCATCTCTTGTCGACGGCCCGTCCGGAG
GCCGCTCAGGCGCTACAGGAGCTCATCGCCGAGACCGACGCCGGCGTGACGCTGCAGATGCAAAAGTTTGCCGCC
TGCAACGAGAGGCTACTGCTGGGCAACGGCCTGATCATCAGCCCCTACGGCGGGCAGGCGGGCAGCGTCGCGACC
CAGCGTCGAAGCCTGCGCGAAGCCGTGGCCGCCATCGACAACACGAGGGATCTCCACGTCTTCGTCGCCGCTCAC
CACGGCAAGATCCAGCCCAAGGCTGAGATCCGATACGAGCGCAACCCTCTCCTCAACCCCCCGGCTCAGACTGCC
GCCCCCGTGTCGGCGCCGCTGACGATGAATCCGCCCGGCCCGACACTGGGGCAGACGTCGACTCCCTCCTTCTCC
TCGTCGGTGCCCGCAGCCGGCTCACGGAGCAGCACCGGCAATCTCGGGCCTGTCGTCGGCTCGCCCGATCCGCCG
CGTCCACTTCAGCCGCCTCACGCGCGGAGCTTCAGCCACGGCACGGCGCAGAACCAACAGCAGCTCGCGACCAAG
CAGCCGCGCTTCGGCAACGGCGCCACCCAGGGACCGCCCCAGCTGGGGGCCCTGCCCTTCCAGGGTGGCCAGCCG
CCTCCTTCCCAGGGCCCGTCGGGCTCCCCGGCTCAAGACGGCCGCTTCCAATCAGGGGGGCCGCCCGCGTACGGA
CAGGGCGGCGGCGCCTCGCTCCCCGTCTTTGGCGTGCCGCTGAGCCGGCTGTACGAGAGGGATAGCCTGGCGGTG
CCGCTGGTGGTGCATCAGTGCATCCAGGCCGTCGACCTGTACGGGCTGGCCGTCGAGGGCATCTACCGCCAGTCG
GGCTCGCTCAACCACATCAACAAGCTCAAGGCCATGTTCGACGCGGATTGCCAAAACCCGGCTCTCGACTTTCGC
AACCCGGAGAGCTTTTACCACGATGTCAACAGCGTCACGGGGCTGTTGAAGCAGTTCTTCCGCGACCTACCGGAC
CCGTTACTGACGATGGAGCACCACGATGCCTTCATCGCCGCTGCCAGTACGTCTCTGTCACTCCTTTTTTTTTTT
TTTTGA
Gene >Ophio5|6425
ATGGCCGACAAGCGCGATTCCTCTGGCCAGGACGGCGAGAGGACCGATAGCCTGACGGCCACTGCAGTTCAGCCC
CCGGCGACGAGCCCGGAAAAGGATGGCGATGCCATCTCCAGCGGCCGCCAGAGCGACGATGTCGTGGTCAATGCG
CCCCGGAGCCCGACCTCTCCGCCTGCCTTTGACAGCGCCCTGTTCCAGCAGGTTCACCAAGTCATGGCCTCCGAG
GTAGCGCTTCCCGGGGGGGGGGGGGGGGGGTTGATGTCCTTAGATTGCGATTGCTAATACTCCCCTAGCTGAGCA
TCCCGACCCTCTTGACTCGCCTCAAGCAGAGCATTGCCTCGGCCAAGGTATATACACATCCGCCACTTTTTTTTC
CTCGACCTCTTCACTGCTTGCCACCGGCTCGAGGCTAACACCCGTTGCAGGAGTTCGCCCTCTTCCTCAAAAAAC
GGTCCACGTTTGAAGACGACCACGCTCAGAGCCTCAAGAAACTCTGTCGACTAACGCTCGAGAGCTCGCGACGCC
CCGAGCACCGGCAAGGATCTTTCGCCCAGTCTTACGAAGAAATGGTCTTCATCCATGACCGCATGGCCGAAAACG
GGCTGCAATTCGCCAATTCCCTCCACCAAATGTACGAGGACCTCATCGAGCTGGCGGCCAGCGCCGAGCGCGGGC
GCAAGATCTGGAAGAGCAACGGCATGTCGGCCGAGCAAAAGGTGGCCGACCTCGAGCAAGCCATGCGCAAGAGCA
AGGCCAAATACGACTCGCTGGCCGACGAGTACGACCGCGCCAGGACGGGCGAGGGCAGGCAGGGAGGCAAGATGC
TGGGCGCCTTCAAGGCGCATAAGTCGGCCGCTCAACACGAGGAAGATTTATTGCGCAAGGTACAGGCCGCCGATC
AAACCTACCACGGCCACGTCAACGCCCTACAGCAGGAAAAGTCCCATCTCTTGTCGACGGCCCGTCCGGAGGCCG
CTCAGGCGCTACAGGAGCTCATCGCCGAGACCGACGCCGGCGTGACGCTGCAGATGCAAAAGTTTGGTGGGCGGT
CCCCCCATTTCCCCTGAACGGCTCTTGCTGACGGCACGTTCCAGCCGCCTGCAACGAGAGGCTACTGCTGGGCAA
CGGCCTGATCATCAGCCCCTACGGCGGGCAGGCGGGCAGCGTCGCGACCCAGCGTCGAAGCCTGCGCGAAGCCGT
GGCCGCCATCGACAACACGAGGGATCTCCACGTCTTCGTCGCCGCTCACCACGGCAAGATCCAGCCCAAGGCTGA
GATCCGATACGAGCGCAACCCTGTTAGTGATCCGTCGTCTCGTGCGCCCCGCCGGCTGACGCGTCTTACCAGCTC
CTCAACCCCCCGGCTCAGACTGCCGCCCCCGTGTCGGCGCCGCTGACGATGAATCCGCCCGGCCCGACACTGGGG
CAGACGTCGACTCCCTCCTTCTCCTCGTCGGTGCCCGCAGCCGGCTCACGGAGCAGCACCGGCAATCTCGGGCCT
GTCGTCGGCTCGCCCGATCCGCCGCGTCCACTTCAGCCGCCTCACGCGCGGAGCTTCAGCCACGGCACGGCGCAG
AACCAACAGCAGCTCGCGACCAAGCAGCCGCGCTTCGGCAACGGCGCCACCCAGGGACCGCCCCAGCTGGGGGCC
CTGCCCTTCCAGGGTGGCCAGCCGCCTCCTTCCCAGGGCCCGTCGGGCTCCCCGGCTCAAGACGGCCGCTTCCAA
TCAGGGGGGCCGCCCGCGTACGGACAGGGCGGCGGCGCCTCGCTCCCCGTCTTTGGCGTGCCGCTGAGCCGGCTG
TACGAGAGGGATAGCCTGGCGGTGCCGCTGGTGGTGCATCAGTGCATCCAGGCCGTCGACCTGTACGGGCTGGCC
GTCGAGGGCATCTACCGCCAGTCGGGCTCGCTCAACCACATCAACAAGCTCAAGGCCATGTTCGACGCGGGTGAG
GCGCGCCGCTGTTCTCCCATGTGTCATTTTTTACCTCTTTCCCTGGCGCTGACCGAGGCCTTCTTTTTTCCATCT
AGATTGCCAAAACCCGGCTCTCGACTTTCGCAACCCGGAGAGCTTTTACCACGATGTCAACAGCGTCACGGGGCT
GTTGAAGCAGTTCTTCCGCGACCTACCGGACCCGTTACTGACGATGGAGCACCACGATGCCTTCATCGCCGCTGC
CAGTACGTCTCTGTCACTCCTTTTTTTTTTTTTTTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail