Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|6420
Gene name
Locationscaffold_56:42978..44982
Strand-
Gene length (bp)2004
Transcript length (bp)2004
Coding sequence length (bp)2001
Protein length (aa) 667

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF04083 Abhydro_lipase Partial alpha/beta-hydrolase lipase region 1.8E-20 249 335

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q07950|YEH2_YEAST Sterol esterase 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YEH2 PE=1 SV=1 245 635 8.0E-76
sp|Q07804|YEH1_YEAST Sterol esterase 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YEH1 PE=1 SV=1 245 656 6.0E-72
sp|P78898|TGCE2_SCHPO Probable lipase C16A3.12c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC16A3.12c PE=3 SV=2 257 635 6.0E-27
sp|P07098|LIPG_HUMAN Gastric triacylglycerol lipase OS=Homo sapiens GN=LIPF PE=1 SV=1 241 635 9.0E-27
sp|Q8K2A6|LIPM_MOUSE Lipase member M OS=Mus musculus GN=Lipm PE=2 SV=1 222 647 3.0E-26
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q07950|YEH2_YEAST Sterol esterase 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YEH2 PE=1 SV=1 245 635 8.0E-76
sp|Q07804|YEH1_YEAST Sterol esterase 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YEH1 PE=1 SV=1 245 656 6.0E-72
sp|P78898|TGCE2_SCHPO Probable lipase C16A3.12c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC16A3.12c PE=3 SV=2 257 635 6.0E-27
sp|P07098|LIPG_HUMAN Gastric triacylglycerol lipase OS=Homo sapiens GN=LIPF PE=1 SV=1 241 635 9.0E-27
sp|Q8K2A6|LIPM_MOUSE Lipase member M OS=Mus musculus GN=Lipm PE=2 SV=1 222 647 3.0E-26
sp|O74430|TGCE1_SCHPO Probable lipase C1672.09 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC1672.09 PE=1 SV=1 248 631 3.0E-26
sp|Q9Z0M5|LICH_MOUSE Lysosomal acid lipase/cholesteryl ester hydrolase OS=Mus musculus GN=Lipa PE=1 SV=2 238 637 2.0E-25
sp|P38571|LICH_HUMAN Lysosomal acid lipase/cholesteryl ester hydrolase OS=Homo sapiens GN=LIPA PE=1 SV=2 216 635 9.0E-25
sp|Q29458|LIPG_BOVIN Gastric triacylglycerol lipase OS=Bos taurus GN=LIPF PE=1 SV=1 248 635 2.0E-24
sp|Q4R4S5|LICH_MACFA Lysosomal acid lipase/cholesteryl ester hydrolase OS=Macaca fascicularis GN=LIPA PE=2 SV=1 216 637 2.0E-24
sp|P80035|LIPG_CANLF Gastric triacylglycerol lipase OS=Canis lupus familiaris GN=LIPF PE=1 SV=2 245 635 8.0E-24
sp|Q9CPP7|LIPG_MOUSE Gastric triacylglycerol lipase OS=Mus musculus GN=Lipf PE=2 SV=1 240 635 5.0E-23
sp|P04634|LIPG_RAT Gastric triacylglycerol lipase OS=Rattus norvegicus GN=Lipf PE=1 SV=1 257 635 2.0E-22
sp|O46107|LIP1_DROME Lipase 1 OS=Drosophila melanogaster GN=Lip1 PE=2 SV=2 255 638 2.0E-22
sp|Q5VXJ0|LIPK_HUMAN Lipase member K OS=Homo sapiens GN=LIPK PE=2 SV=2 257 631 2.0E-21
sp|Q64194|LICH_RAT Lysosomal acid lipase/cholesteryl ester hydrolase OS=Rattus norvegicus GN=Lipa PE=2 SV=1 265 637 3.0E-21
sp|Q5VXI9|LIPN_HUMAN Lipase member N OS=Homo sapiens GN=LIPN PE=2 SV=2 220 635 4.0E-21
sp|Q5VYY2|LIPM_HUMAN Lipase member M OS=Homo sapiens GN=LIPM PE=2 SV=2 235 440 2.0E-20
sp|J3SDX8|LICH_CROAD Putative lysosomal acid lipase/cholesteryl ester hydrolase OS=Crotalus adamanteus PE=2 SV=1 241 638 3.0E-20
sp|Q3U4B4|LIPN_MOUSE Lipase member N OS=Mus musculus GN=Lipn PE=2 SV=1 257 635 4.0E-20
sp|Q5W064|LIPJ_HUMAN Lipase member J OS=Homo sapiens GN=LIPJ PE=2 SV=3 257 635 2.0E-19
sp|Q8BM14|LIPK_MOUSE Lipase member K OS=Mus musculus GN=Lipk PE=2 SV=1 249 635 4.0E-19
sp|O60095|TGCE3_SCHPO Probable lipase C14C8.15 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC14C8.15 PE=3 SV=1 257 635 4.0E-19
sp|P34163|TGL1_YEAST Sterol esterase TGL1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TGL1 PE=1 SV=1 258 631 7.0E-19
sp|O46108|LIP3_DROME Lipase 3 OS=Drosophila melanogaster GN=Lip3 PE=2 SV=1 307 631 2.0E-18
sp|Q3YBN2|TALLP_MESAU Tear acid lipase-like protein OS=Mesocricetus auratus PE=1 SV=1 249 472 2.0E-16
sp|Q71DJ5|LIP1_ARATH Triacylglycerol lipase 1 OS=Arabidopsis thaliana GN=LIP1 PE=1 SV=1 265 451 2.0E-12
sp|Q67ZU1|LIP2_ARATH Triacylglycerol lipase 2 OS=Arabidopsis thaliana GN=LIP2 PE=2 SV=1 257 441 8.0E-12
[Show less]

GO

GO Term Description Terminal node
GO:0006629 lipid metabolic process Yes
GO:0071704 organic substance metabolic process No
GO:0044238 primary metabolic process No
GO:0008152 metabolic process No
GO:0008150 biological_process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 47 0.45

Transmembrane Domains

Domain # Start End Length
1 157 179 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
SC16a Pure fungal culture 73.42 39.59 107.26
CcL In ants, during behavior modification 119.44 58.37 180.52
CcD In ants, recently dead 53.35 29.16 77.54

Differential expression

Label1 Label2 Q-value Significant difference
SC16a CcL 0.040344 yes
SC16a CcD 0.168141 no
CcL CcD 0.000286 yes

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|6420
MKTTEDDANPLALTVAKFTKQAARLSRKLSASGSSSAAIQAHLVTPQDLILSTPDGSRLPGVPLLSGANAHASGR
LEVTECRQDEPNCIKTESPSDDMPEHIVHVPPWQNGRILQKSAENSLRKSMPPSQTHPLFPPLPLYGPPSLLRTA
QCLFYRLSSFSLSLLFLGVIVAGSLVSSVPTVCRRMWLLAGDRQRPFYEEEMRRSEIRRHARKNWERRASGGFLV
QDDEETADEYSPTEGGKDPIVCDVSYYARRVGLDAETFLVQTEDGFILELWHIYDPKEYAPRDEKTRAPRDPSAT
AMPKRQPEVAEKGRRFPVLLMHGLLQSSGAYCCNDDESLAFWLCKSGFDVWLGNNRCGFRPRHQTLDYGDPRMWC
WNIRQMGILDLPALTGRVLAETGFAKIGLICHSQGTTQTLVALAKEQRPELGDRLTVFCALAPAAYAGPLIGKIY
FEFMRVISPPVFRAVFGIHAFIPFMMQMHRLLPPRLYGWMGYKVFSYLFDWSDARWDRELRDRMFQFAPVYVSAE
SMRWWLGRECFAKHKCILATQETTRAEDQMSEDEVEAAAWYDEHAPPFALWVCGNDDLVDGKRLLRRFEQGREPH
VRVVHSKVVDEYEHLDVIWAMDAVDQVFKEVREVLWKTCDARDVCRVPAGCEAIDVSEGKKGETWSV
Coding >Ophio5|6420
ATGAAAACCACTGAAGACGACGCGAATCCGCTGGCGCTGACGGTCGCCAAGTTCACCAAGCAGGCCGCCAGGCTC
TCTCGGAAACTCTCCGCATCGGGCTCTTCCTCGGCAGCCATCCAGGCCCACCTGGTCACGCCCCAAGACCTCATC
TTGAGCACTCCGGATGGCAGTCGGTTGCCTGGCGTCCCGTTGCTCTCTGGCGCCAACGCACATGCTTCGGGGAGG
TTGGAAGTCACCGAATGCCGTCAAGACGAGCCCAATTGCATCAAGACGGAGAGCCCGAGCGACGACATGCCAGAA
CACATTGTCCATGTGCCCCCGTGGCAAAATGGCAGGATCCTGCAAAAGTCGGCCGAGAATTCGCTGCGCAAGTCG
ATGCCCCCGTCTCAGACGCACCCCCTATTTCCACCTCTTCCTCTCTACGGTCCGCCGTCGCTCCTGCGCACCGCC
CAGTGCCTGTTCTACCGGCTGTCGTCCTTTTCTCTAAGTCTTCTTTTTCTTGGCGTCATCGTCGCCGGGTCGCTT
GTGAGCAGCGTCCCAACAGTCTGTCGCAGGATGTGGCTCCTCGCCGGCGACCGGCAGCGCCCGTTTTACGAAGAG
GAAATGCGACGGTCGGAAATAAGGAGGCATGCACGCAAAAACTGGGAAAGGAGAGCTTCGGGAGGCTTCCTCGTC
CAGGATGACGAGGAGACGGCCGACGAGTATTCCCCGACGGAAGGGGGAAAGGATCCGATTGTATGCGACGTCAGT
TACTACGCGAGACGGGTCGGACTCGATGCCGAGACATTTTTGGTGCAGACGGAGGACGGCTTCATCCTGGAGCTG
TGGCACATCTATGACCCAAAGGAATACGCGCCACGCGATGAGAAGACGAGAGCCCCCCGCGACCCGTCAGCCACG
GCTATGCCCAAGCGGCAGCCCGAGGTGGCGGAAAAGGGGAGGCGATTCCCCGTGCTCCTGATGCACGGGCTACTG
CAGAGCTCCGGGGCGTACTGCTGTAACGACGACGAGTCGCTAGCCTTTTGGCTCTGTAAGTCCGGCTTCGACGTC
TGGCTGGGCAACAACCGGTGCGGGTTCCGGCCTCGACACCAGACGCTCGATTATGGCGACCCTCGCATGTGGTGC
TGGAACATCCGCCAGATGGGCATCCTGGACCTGCCGGCGTTGACAGGGAGGGTGTTGGCCGAGACGGGCTTCGCC
AAGATTGGCCTCATCTGCCACTCTCAGGGGACGACACAGACGCTGGTGGCGCTCGCCAAAGAGCAGCGGCCGGAG
CTCGGAGACCGGCTTACGGTATTTTGCGCCCTGGCGCCAGCGGCGTATGCTGGACCGCTTATCGGCAAGATATAC
TTCGAGTTCATGCGGGTGATATCACCGCCCGTATTCCGAGCCGTGTTCGGGATACACGCCTTTATCCCATTCATG
ATGCAGATGCATCGGCTGCTACCACCGCGGTTGTACGGCTGGATGGGATACAAGGTCTTTTCCTACCTGTTCGAC
TGGTCAGACGCGCGATGGGACCGAGAACTGCGAGACCGCATGTTCCAGTTCGCGCCCGTATACGTCAGTGCCGAG
TCGATGCGCTGGTGGCTGGGACGGGAATGCTTCGCCAAGCACAAGTGCATCCTGGCAACGCAGGAGACGACAAGA
GCCGAGGACCAGATGAGCGAGGACGAGGTGGAGGCGGCGGCATGGTACGACGAACACGCGCCACCGTTTGCTCTC
TGGGTTTGCGGCAACGACGATCTGGTGGACGGGAAGAGACTGCTTCGGCGTTTCGAGCAGGGACGCGAGCCTCAC
GTACGGGTGGTGCACAGCAAGGTGGTGGACGAGTACGAGCACCTCGACGTCATCTGGGCCATGGACGCGGTTGAC
CAGGTGTTCAAGGAGGTGCGGGAGGTGCTGTGGAAGACGTGTGACGCACGGGATGTTTGCCGCGTGCCGGCGGGC
TGCGAGGCTATCGACGTTTCAGAGGGCAAAAAGGGGGAAACTTGGAGTGTA
Transcript >Ophio5|6420
ATGAAAACCACTGAAGACGACGCGAATCCGCTGGCGCTGACGGTCGCCAAGTTCACCAAGCAGGCCGCCAGGCTC
TCTCGGAAACTCTCCGCATCGGGCTCTTCCTCGGCAGCCATCCAGGCCCACCTGGTCACGCCCCAAGACCTCATC
TTGAGCACTCCGGATGGCAGTCGGTTGCCTGGCGTCCCGTTGCTCTCTGGCGCCAACGCACATGCTTCGGGGAGG
TTGGAAGTCACCGAATGCCGTCAAGACGAGCCCAATTGCATCAAGACGGAGAGCCCGAGCGACGACATGCCAGAA
CACATTGTCCATGTGCCCCCGTGGCAAAATGGCAGGATCCTGCAAAAGTCGGCCGAGAATTCGCTGCGCAAGTCG
ATGCCCCCGTCTCAGACGCACCCCCTATTTCCACCTCTTCCTCTCTACGGTCCGCCGTCGCTCCTGCGCACCGCC
CAGTGCCTGTTCTACCGGCTGTCGTCCTTTTCTCTAAGTCTTCTTTTTCTTGGCGTCATCGTCGCCGGGTCGCTT
GTGAGCAGCGTCCCAACAGTCTGTCGCAGGATGTGGCTCCTCGCCGGCGACCGGCAGCGCCCGTTTTACGAAGAG
GAAATGCGACGGTCGGAAATAAGGAGGCATGCACGCAAAAACTGGGAAAGGAGAGCTTCGGGAGGCTTCCTCGTC
CAGGATGACGAGGAGACGGCCGACGAGTATTCCCCGACGGAAGGGGGAAAGGATCCGATTGTATGCGACGTCAGT
TACTACGCGAGACGGGTCGGACTCGATGCCGAGACATTTTTGGTGCAGACGGAGGACGGCTTCATCCTGGAGCTG
TGGCACATCTATGACCCAAAGGAATACGCGCCACGCGATGAGAAGACGAGAGCCCCCCGCGACCCGTCAGCCACG
GCTATGCCCAAGCGGCAGCCCGAGGTGGCGGAAAAGGGGAGGCGATTCCCCGTGCTCCTGATGCACGGGCTACTG
CAGAGCTCCGGGGCGTACTGCTGTAACGACGACGAGTCGCTAGCCTTTTGGCTCTGTAAGTCCGGCTTCGACGTC
TGGCTGGGCAACAACCGGTGCGGGTTCCGGCCTCGACACCAGACGCTCGATTATGGCGACCCTCGCATGTGGTGC
TGGAACATCCGCCAGATGGGCATCCTGGACCTGCCGGCGTTGACAGGGAGGGTGTTGGCCGAGACGGGCTTCGCC
AAGATTGGCCTCATCTGCCACTCTCAGGGGACGACACAGACGCTGGTGGCGCTCGCCAAAGAGCAGCGGCCGGAG
CTCGGAGACCGGCTTACGGTATTTTGCGCCCTGGCGCCAGCGGCGTATGCTGGACCGCTTATCGGCAAGATATAC
TTCGAGTTCATGCGGGTGATATCACCGCCCGTATTCCGAGCCGTGTTCGGGATACACGCCTTTATCCCATTCATG
ATGCAGATGCATCGGCTGCTACCACCGCGGTTGTACGGCTGGATGGGATACAAGGTCTTTTCCTACCTGTTCGAC
TGGTCAGACGCGCGATGGGACCGAGAACTGCGAGACCGCATGTTCCAGTTCGCGCCCGTATACGTCAGTGCCGAG
TCGATGCGCTGGTGGCTGGGACGGGAATGCTTCGCCAAGCACAAGTGCATCCTGGCAACGCAGGAGACGACAAGA
GCCGAGGACCAGATGAGCGAGGACGAGGTGGAGGCGGCGGCATGGTACGACGAACACGCGCCACCGTTTGCTCTC
TGGGTTTGCGGCAACGACGATCTGGTGGACGGGAAGAGACTGCTTCGGCGTTTCGAGCAGGGACGCGAGCCTCAC
GTACGGGTGGTGCACAGCAAGGTGGTGGACGAGTACGAGCACCTCGACGTCATCTGGGCCATGGACGCGGTTGAC
CAGGTGTTCAAGGAGGTGCGGGAGGTGCTGTGGAAGACGTGTGACGCACGGGATGTTTGCCGCGTGCCGGCGGGC
TGCGAGGCTATCGACGTTTCAGAGGGCAAAAAGGGGGAAACTTGGAGTGTATAA
Gene >Ophio5|6420
ATGAAAACCACTGAAGACGACGCGAATCCGCTGGCGCTGACGGTCGCCAAGTTCACCAAGCAGGCCGCCAGGCTC
TCTCGGAAACTCTCCGCATCGGGCTCTTCCTCGGCAGCCATCCAGGCCCACCTGGTCACGCCCCAAGACCTCATC
TTGAGCACTCCGGATGGCAGTCGGTTGCCTGGCGTCCCGTTGCTCTCTGGCGCCAACGCACATGCTTCGGGGAGG
TTGGAAGTCACCGAATGCCGTCAAGACGAGCCCAATTGCATCAAGACGGAGAGCCCGAGCGACGACATGCCAGAA
CACATTGTCCATGTGCCCCCGTGGCAAAATGGCAGGATCCTGCAAAAGTCGGCCGAGAATTCGCTGCGCAAGTCG
ATGCCCCCGTCTCAGACGCACCCCCTATTTCCACCTCTTCCTCTCTACGGTCCGCCGTCGCTCCTGCGCACCGCC
CAGTGCCTGTTCTACCGGCTGTCGTCCTTTTCTCTAAGTCTTCTTTTTCTTGGCGTCATCGTCGCCGGGTCGCTT
GTGAGCAGCGTCCCAACAGTCTGTCGCAGGATGTGGCTCCTCGCCGGCGACCGGCAGCGCCCGTTTTACGAAGAG
GAAATGCGACGGTCGGAAATAAGGAGGCATGCACGCAAAAACTGGGAAAGGAGAGCTTCGGGAGGCTTCCTCGTC
CAGGATGACGAGGAGACGGCCGACGAGTATTCCCCGACGGAAGGGGGAAAGGATCCGATTGTATGCGACGTCAGT
TACTACGCGAGACGGGTCGGACTCGATGCCGAGACATTTTTGGTGCAGACGGAGGACGGCTTCATCCTGGAGCTG
TGGCACATCTATGACCCAAAGGAATACGCGCCACGCGATGAGAAGACGAGAGCCCCCCGCGACCCGTCAGCCACG
GCTATGCCCAAGCGGCAGCCCGAGGTGGCGGAAAAGGGGAGGCGATTCCCCGTGCTCCTGATGCACGGGCTACTG
CAGAGCTCCGGGGCGTACTGCTGTAACGACGACGAGTCGCTAGCCTTTTGGCTCTGTAAGTCCGGCTTCGACGTC
TGGCTGGGCAACAACCGGTGCGGGTTCCGGCCTCGACACCAGACGCTCGATTATGGCGACCCTCGCATGTGGTGC
TGGAACATCCGCCAGATGGGCATCCTGGACCTGCCGGCGTTGACAGGGAGGGTGTTGGCCGAGACGGGCTTCGCC
AAGATTGGCCTCATCTGCCACTCTCAGGGGACGACACAGACGCTGGTGGCGCTCGCCAAAGAGCAGCGGCCGGAG
CTCGGAGACCGGCTTACGGTATTTTGCGCCCTGGCGCCAGCGGCGTATGCTGGACCGCTTATCGGCAAGATATAC
TTCGAGTTCATGCGGGTGATATCACCGCCCGTATTCCGAGCCGTGTTCGGGATACACGCCTTTATCCCATTCATG
ATGCAGATGCATCGGCTGCTACCACCGCGGTTGTACGGCTGGATGGGATACAAGGTCTTTTCCTACCTGTTCGAC
TGGTCAGACGCGCGATGGGACCGAGAACTGCGAGACCGCATGTTCCAGTTCGCGCCCGTATACGTCAGTGCCGAG
TCGATGCGCTGGTGGCTGGGACGGGAATGCTTCGCCAAGCACAAGTGCATCCTGGCAACGCAGGAGACGACAAGA
GCCGAGGACCAGATGAGCGAGGACGAGGTGGAGGCGGCGGCATGGTACGACGAACACGCGCCACCGTTTGCTCTC
TGGGTTTGCGGCAACGACGATCTGGTGGACGGGAAGAGACTGCTTCGGCGTTTCGAGCAGGGACGCGAGCCTCAC
GTACGGGTGGTGCACAGCAAGGTGGTGGACGAGTACGAGCACCTCGACGTCATCTGGGCCATGGACGCGGTTGAC
CAGGTGTTCAAGGAGGTGCGGGAGGTGCTGTGGAAGACGTGTGACGCACGGGATGTTTGCCGCGTGCCGGCGGGC
TGCGAGGCTATCGACGTTTCAGAGGGCAAAAAGGGGGAAACTTGGAGTGTATAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail