Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|6417
Gene name
Locationscaffold_56:34622..38452
Strand-
Gene length (bp)3830
Transcript length (bp)3561
Coding sequence length (bp)3558
Protein length (aa) 1186

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF14500 MMS19_N Dos2-interacting transcription regulator of RNA-Pol-II 1.1E-48 69 326
PF12460 MMS19_C RNAPII transcription regulator C-terminal 1.1E-09 881 1093

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|E1BP36|MMS19_BOVIN MMS19 nucleotide excision repair protein homolog OS=Bos taurus GN=MMS19 PE=2 SV=3 7 355 5.0E-15
sp|Q96T76|MMS19_HUMAN MMS19 nucleotide excision repair protein homolog OS=Homo sapiens GN=MMS19 PE=1 SV=2 58 355 1.0E-13
sp|E7FBU4|MMS19_DANRE MMS19 nucleotide excision repair protein homolog OS=Danio rerio GN=mms19 PE=3 SV=1 71 355 5.0E-13
sp|Q9D071|MMS19_MOUSE MMS19 nucleotide excision repair protein homolog OS=Mus musculus GN=Mms19 PE=1 SV=1 71 355 2.0E-12
sp|Q0V9L1|MMS19_XENTR MMS19 nucleotide excision repair protein homolog OS=Xenopus tropicalis GN=mms19 PE=2 SV=2 67 423 8.0E-12
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|E1BP36|MMS19_BOVIN MMS19 nucleotide excision repair protein homolog OS=Bos taurus GN=MMS19 PE=2 SV=3 7 355 5.0E-15
sp|Q96T76|MMS19_HUMAN MMS19 nucleotide excision repair protein homolog OS=Homo sapiens GN=MMS19 PE=1 SV=2 58 355 1.0E-13
sp|E7FBU4|MMS19_DANRE MMS19 nucleotide excision repair protein homolog OS=Danio rerio GN=mms19 PE=3 SV=1 71 355 5.0E-13
sp|Q9D071|MMS19_MOUSE MMS19 nucleotide excision repair protein homolog OS=Mus musculus GN=Mms19 PE=1 SV=1 71 355 2.0E-12
sp|Q0V9L1|MMS19_XENTR MMS19 nucleotide excision repair protein homolog OS=Xenopus tropicalis GN=mms19 PE=2 SV=2 67 423 8.0E-12
sp|Q6DCF2|MMS19_XENLA MMS19 nucleotide excision repair protein homolog OS=Xenopus laevis GN=mms19 PE=2 SV=1 67 423 1.0E-11
sp|Q54J88|MMS19_DICDI MMS19 nucleotide excision repair protein homolog OS=Dictyostelium discoideum GN=mms19 PE=3 SV=2 187 419 2.0E-10
sp|P40469|MET18_YEAST DNA repair/transcription protein MET18/MMS19 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MET18 PE=1 SV=1 135 326 7.0E-07
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 19 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|6417
MADFRQLALDFILEDDEATLTNIARRAASEIESASLGSNPVARWVEAVQPWMPGSDDDAMRDDGDIPDWTTRAKA
LEFLSRTLLLLDQGLLKPSQVNLLVAFFGAMFDVDHKAGIMASATALSRIVTMKSFQPSSGRSIIQMVCALKDDF
PRQVAKTRLAIYRLLRSIITDAAVARDLESGGGDGAFMCRLLHLCQNERDPECLMVWLDTLRFFAAEYSSSEAVL
DDVYGAFKAYFPITVPRASQSGLTPEELKLQLRRCFSSNGRLAPQTLPFLLEKLDQGDGVTVNVKIDILRTLRAC
LEEYAHPQQSVAPFAGRVWDSLKYEVRNGDVEDTVWATLEVLKALTTRLEGDALREFALTVTRECVDDLSSQAYA
AAAGRLLISVLSADARAFALMASPAVTHIKENLRHPKSSTHKLDLLKILRILLETRLLLADMQMPDPERQDFGAT
DSVFRPLYGDVYRGLVEATDGADASYDVKVTTEAVQGVGALVCQRLSRAAATDEQRTADLLLPQEICAQICDALF
SLAARSWELQSPQAASYELINESIKALRRATEAYPLGFQPLMERGLATIRNSYASAVAESVSTIQRVSSVVAFVG
CSGLKPSLAHAMRCFLALTCALTWELSAAMDDKRDNRLWCALVAGIETAVHYFKDAFTDVSLEDPLQRPHEDESP
SPALWLATIMTRYPLLSSIDSADTPSALDIDTLAIPKVDSAFALRDDFLLVSLVICRHLYRRVTKPLETQGEEAM
ALGLGDDFTGADPEVTYRYLSMLSDLASFIVGEMGRSGCPSPQIEAYFLTLFRHDSIALPPVGAVQPPGSWRWLA
TGPLSVLSWGILRSMPPVGVARLYDIGVAQRMLLDGTSSAFHGDHAADGLPVTRAILSVLANKYKLETVDGVMTA
IEQDAQSALKQAAMGSSPEDQRQGLDQALTIFTLAGSLARRSTGHRTRALLDLLRPAPEDHTAGYRLARGLELVV
APQTFLTDSVGSVQRPLWMQKVYVDLVKPMMGAATGTSSVEARSRSIQTNYGIAVLAMVKHMRYPVYEEDSSTII
RIAISTAQKLGIGPDTRAALQVINSVLGEAPEVVQDHLGSLISICTSVFTSEPPTTQTDDESPTTQTDDESPEET
QAGCAKLALEMVGRLPQTLESRHLLAHAPAVRRQLAAACGHRVRDLRRLARLARTAWADLK
Coding >Ophio5|6417
ATGGCCGACTTCCGCCAGCTCGCCCTCGATTTCATCCTGGAGGACGACGAGGCGACGTTGACGAACATCGCCCGC
CGCGCGGCATCAGAGATCGAATCTGCCTCCTTGGGCTCCAATCCTGTCGCTCGCTGGGTTGAGGCTGTCCAGCCG
TGGATGCCGGGGAGCGACGATGATGCTATGCGCGATGATGGAGATATTCCGGACTGGACCACACGCGCCAAGGCT
TTGGAGTTTCTCTCTCGTACCCTGCTTCTCCTAGACCAGGGCCTTTTGAAGCCGAGTCAAGTCAACCTCCTCGTC
GCCTTCTTCGGCGCCATGTTCGATGTCGACCACAAGGCCGGCATCATGGCCTCCGCCACGGCCCTTTCGCGCATC
GTCACTATGAAGTCATTTCAGCCGTCGAGTGGCCGCAGCATTATCCAGATGGTGTGTGCTCTCAAGGATGACTTT
CCTCGTCAAGTGGCAAAGACGCGTTTGGCAATTTACCGTCTTCTTCGTTCCATCATTACCGATGCCGCCGTTGCC
CGCGACCTCGAATCCGGCGGGGGTGATGGGGCTTTCATGTGCCGTCTGCTTCATCTCTGCCAGAACGAGAGGGAT
CCGGAATGCCTGATGGTGTGGCTCGATACTCTACGCTTCTTCGCGGCCGAATATTCTTCTTCGGAAGCAGTCCTG
GACGACGTTTACGGAGCCTTCAAGGCCTACTTTCCCATCACCGTGCCTCGCGCGTCCCAGAGTGGTTTGACGCCC
GAGGAGCTCAAGCTTCAATTGCGGCGATGCTTCTCTTCTAACGGCCGTTTGGCTCCTCAAACTTTGCCCTTTCTG
CTGGAGAAGCTGGATCAGGGGGACGGTGTGACTGTCAATGTCAAGATTGATATTCTTCGCACACTGAGGGCCTGC
CTTGAGGAATACGCTCATCCCCAGCAGTCGGTCGCGCCATTCGCTGGCAGAGTGTGGGATAGCCTCAAGTACGAG
GTGCGCAATGGCGACGTTGAGGATACCGTTTGGGCCACTCTCGAGGTGCTCAAGGCGCTCACCACGAGGTTGGAA
GGCGACGCGCTGCGAGAGTTCGCCCTGACCGTCACCCGCGAGTGCGTTGACGACCTCTCAAGCCAGGCCTACGCT
GCCGCTGCTGGAAGGTTGCTCATCAGTGTATTGAGCGCAGATGCACGTGCCTTTGCTCTCATGGCTTCGCCGGCC
GTAACGCACATCAAAGAAAACCTGCGGCATCCCAAGTCGTCGACGCATAAGCTCGATTTGCTCAAGATTCTGCGC
ATCCTTCTCGAGACGAGACTGCTCCTCGCAGATATGCAGATGCCAGACCCGGAGAGGCAAGACTTTGGAGCCACA
GACTCCGTCTTCCGGCCGCTCTACGGCGACGTCTATCGAGGTCTGGTCGAGGCGACGGATGGAGCAGACGCTTCC
TACGACGTTAAAGTGACGACCGAAGCTGTTCAGGGCGTGGGCGCGCTCGTCTGCCAGCGGTTATCGAGGGCGGCG
GCCACCGATGAGCAGCGCACCGCAGATCTGCTACTCCCTCAAGAGATATGTGCTCAGATCTGCGACGCGCTCTTC
TCCCTTGCAGCCCGGTCCTGGGAGTTGCAGTCGCCGCAGGCCGCATCTTACGAGCTCATCAACGAGAGTATCAAG
GCGCTACGACGGGCCACTGAGGCTTATCCTCTGGGCTTCCAGCCATTGATGGAGAGAGGTCTGGCAACGATTCGG
AACAGCTACGCCAGCGCCGTCGCCGAGTCTGTCTCTACAATCCAAAGGGTGTCGTCTGTCGTCGCCTTTGTGGGA
TGCTCAGGGCTGAAGCCGTCTCTGGCGCACGCCATGAGATGCTTCCTGGCTCTCACATGTGCTTTGACTTGGGAG
CTTTCGGCGGCAATGGACGACAAGCGAGATAATCGCCTGTGGTGTGCGTTAGTGGCCGGTATCGAGACGGCCGTT
CACTACTTTAAAGATGCCTTTACCGACGTGAGCTTAGAGGATCCCTTACAAAGGCCGCACGAAGACGAGTCGCCG
TCGCCGGCCCTTTGGCTGGCAACCATCATGACGAGATACCCCCTATTGAGCTCGATAGATAGCGCCGACACGCCA
TCAGCTCTTGACATCGACACGCTGGCGATTCCCAAAGTCGACTCTGCCTTTGCGCTTCGTGACGATTTTCTGCTC
GTCAGTCTCGTCATATGCCGCCACCTTTACCGCAGGGTCACAAAGCCGTTGGAGACGCAAGGCGAGGAGGCTATG
GCCCTCGGCCTTGGGGATGACTTTACCGGCGCTGACCCGGAAGTTACATATCGCTATCTTTCTATGCTGTCTGAC
CTCGCCAGTTTCATCGTGGGAGAGATGGGTCGATCTGGGTGTCCATCGCCGCAGATTGAAGCCTATTTCCTGACT
CTATTCCGCCATGACAGCATTGCTCTCCCGCCGGTAGGAGCTGTACAACCTCCTGGCTCGTGGCGCTGGCTGGCT
ACGGGACCTTTGAGTGTGCTATCTTGGGGCATTCTTAGGTCTATGCCTCCGGTCGGGGTTGCGCGACTGTACGAT
ATTGGTGTCGCTCAGCGAATGCTGCTTGACGGCACCTCGTCTGCTTTCCATGGTGACCACGCTGCGGACGGCCTG
CCCGTTACGAGGGCCATTCTATCTGTCCTGGCCAACAAGTACAAGCTCGAGACGGTAGATGGCGTGATGACGGCC
ATCGAGCAAGACGCCCAGAGCGCCCTGAAGCAGGCGGCGATGGGATCTAGTCCAGAAGACCAACGACAGGGGCTG
GACCAAGCCCTGACCATCTTTACGCTCGCGGGCAGCCTGGCACGGCGGTCTACCGGCCACCGAACACGGGCCTTG
CTGGATCTGCTACGGCCGGCGCCCGAAGATCACACGGCGGGCTATCGTCTGGCGAGGGGATTGGAGCTGGTCGTT
GCACCCCAGACGTTCCTTACAGACAGCGTCGGATCCGTCCAACGGCCTCTCTGGATGCAGAAAGTCTACGTCGAC
CTCGTCAAGCCCATGATGGGTGCCGCCACGGGCACCTCCTCCGTCGAGGCACGGAGCCGGTCGATACAGACAAAC
TACGGCATTGCCGTGCTGGCCATGGTCAAGCACATGCGCTACCCCGTCTACGAGGAGGACTCCAGCACCATCATA
CGCATAGCCATCTCTACGGCACAGAAACTAGGCATCGGTCCCGACACGAGAGCTGCACTTCAGGTGATCAACAGC
GTGCTAGGCGAGGCCCCGGAGGTCGTACAGGATCACCTCGGGAGCCTCATCTCCATCTGCACTAGCGTCTTCACC
AGCGAGCCGCCGACGACGCAGACCGACGACGAGTCGCCGACGACGCAAACCGACGACGAGTCGCCGGAAGAGACG
CAGGCTGGCTGTGCCAAGCTGGCTCTTGAGATGGTCGGCCGCCTGCCGCAGACGCTGGAGTCGAGACATCTCTTG
GCCCATGCGCCTGCGGTGCGGCGACAGCTGGCTGCCGCGTGTGGACACAGGGTTCGGGACCTGAGGAGGTTGGCG
CGGCTTGCGCGGACGGCCTGGGCGGACTTGAAG
Transcript >Ophio5|6417
ATGGCCGACTTCCGCCAGCTCGCCCTCGATTTCATCCTGGAGGACGACGAGGCGACGTTGACGAACATCGCCCGC
CGCGCGGCATCAGAGATCGAATCTGCCTCCTTGGGCTCCAATCCTGTCGCTCGCTGGGTTGAGGCTGTCCAGCCG
TGGATGCCGGGGAGCGACGATGATGCTATGCGCGATGATGGAGATATTCCGGACTGGACCACACGCGCCAAGGCT
TTGGAGTTTCTCTCTCGTACCCTGCTTCTCCTAGACCAGGGCCTTTTGAAGCCGAGTCAAGTCAACCTCCTCGTC
GCCTTCTTCGGCGCCATGTTCGATGTCGACCACAAGGCCGGCATCATGGCCTCCGCCACGGCCCTTTCGCGCATC
GTCACTATGAAGTCATTTCAGCCGTCGAGTGGCCGCAGCATTATCCAGATGGTGTGTGCTCTCAAGGATGACTTT
CCTCGTCAAGTGGCAAAGACGCGTTTGGCAATTTACCGTCTTCTTCGTTCCATCATTACCGATGCCGCCGTTGCC
CGCGACCTCGAATCCGGCGGGGGTGATGGGGCTTTCATGTGCCGTCTGCTTCATCTCTGCCAGAACGAGAGGGAT
CCGGAATGCCTGATGGTGTGGCTCGATACTCTACGCTTCTTCGCGGCCGAATATTCTTCTTCGGAAGCAGTCCTG
GACGACGTTTACGGAGCCTTCAAGGCCTACTTTCCCATCACCGTGCCTCGCGCGTCCCAGAGTGGTTTGACGCCC
GAGGAGCTCAAGCTTCAATTGCGGCGATGCTTCTCTTCTAACGGCCGTTTGGCTCCTCAAACTTTGCCCTTTCTG
CTGGAGAAGCTGGATCAGGGGGACGGTGTGACTGTCAATGTCAAGATTGATATTCTTCGCACACTGAGGGCCTGC
CTTGAGGAATACGCTCATCCCCAGCAGTCGGTCGCGCCATTCGCTGGCAGAGTGTGGGATAGCCTCAAGTACGAG
GTGCGCAATGGCGACGTTGAGGATACCGTTTGGGCCACTCTCGAGGTGCTCAAGGCGCTCACCACGAGGTTGGAA
GGCGACGCGCTGCGAGAGTTCGCCCTGACCGTCACCCGCGAGTGCGTTGACGACCTCTCAAGCCAGGCCTACGCT
GCCGCTGCTGGAAGGTTGCTCATCAGTGTATTGAGCGCAGATGCACGTGCCTTTGCTCTCATGGCTTCGCCGGCC
GTAACGCACATCAAAGAAAACCTGCGGCATCCCAAGTCGTCGACGCATAAGCTCGATTTGCTCAAGATTCTGCGC
ATCCTTCTCGAGACGAGACTGCTCCTCGCAGATATGCAGATGCCAGACCCGGAGAGGCAAGACTTTGGAGCCACA
GACTCCGTCTTCCGGCCGCTCTACGGCGACGTCTATCGAGGTCTGGTCGAGGCGACGGATGGAGCAGACGCTTCC
TACGACGTTAAAGTGACGACCGAAGCTGTTCAGGGCGTGGGCGCGCTCGTCTGCCAGCGGTTATCGAGGGCGGCG
GCCACCGATGAGCAGCGCACCGCAGATCTGCTACTCCCTCAAGAGATATGTGCTCAGATCTGCGACGCGCTCTTC
TCCCTTGCAGCCCGGTCCTGGGAGTTGCAGTCGCCGCAGGCCGCATCTTACGAGCTCATCAACGAGAGTATCAAG
GCGCTACGACGGGCCACTGAGGCTTATCCTCTGGGCTTCCAGCCATTGATGGAGAGAGGTCTGGCAACGATTCGG
AACAGCTACGCCAGCGCCGTCGCCGAGTCTGTCTCTACAATCCAAAGGGTGTCGTCTGTCGTCGCCTTTGTGGGA
TGCTCAGGGCTGAAGCCGTCTCTGGCGCACGCCATGAGATGCTTCCTGGCTCTCACATGTGCTTTGACTTGGGAG
CTTTCGGCGGCAATGGACGACAAGCGAGATAATCGCCTGTGGTGTGCGTTAGTGGCCGGTATCGAGACGGCCGTT
CACTACTTTAAAGATGCCTTTACCGACGTGAGCTTAGAGGATCCCTTACAAAGGCCGCACGAAGACGAGTCGCCG
TCGCCGGCCCTTTGGCTGGCAACCATCATGACGAGATACCCCCTATTGAGCTCGATAGATAGCGCCGACACGCCA
TCAGCTCTTGACATCGACACGCTGGCGATTCCCAAAGTCGACTCTGCCTTTGCGCTTCGTGACGATTTTCTGCTC
GTCAGTCTCGTCATATGCCGCCACCTTTACCGCAGGGTCACAAAGCCGTTGGAGACGCAAGGCGAGGAGGCTATG
GCCCTCGGCCTTGGGGATGACTTTACCGGCGCTGACCCGGAAGTTACATATCGCTATCTTTCTATGCTGTCTGAC
CTCGCCAGTTTCATCGTGGGAGAGATGGGTCGATCTGGGTGTCCATCGCCGCAGATTGAAGCCTATTTCCTGACT
CTATTCCGCCATGACAGCATTGCTCTCCCGCCGGTAGGAGCTGTACAACCTCCTGGCTCGTGGCGCTGGCTGGCT
ACGGGACCTTTGAGTGTGCTATCTTGGGGCATTCTTAGGTCTATGCCTCCGGTCGGGGTTGCGCGACTGTACGAT
ATTGGTGTCGCTCAGCGAATGCTGCTTGACGGCACCTCGTCTGCTTTCCATGGTGACCACGCTGCGGACGGCCTG
CCCGTTACGAGGGCCATTCTATCTGTCCTGGCCAACAAGTACAAGCTCGAGACGGTAGATGGCGTGATGACGGCC
ATCGAGCAAGACGCCCAGAGCGCCCTGAAGCAGGCGGCGATGGGATCTAGTCCAGAAGACCAACGACAGGGGCTG
GACCAAGCCCTGACCATCTTTACGCTCGCGGGCAGCCTGGCACGGCGGTCTACCGGCCACCGAACACGGGCCTTG
CTGGATCTGCTACGGCCGGCGCCCGAAGATCACACGGCGGGCTATCGTCTGGCGAGGGGATTGGAGCTGGTCGTT
GCACCCCAGACGTTCCTTACAGACAGCGTCGGATCCGTCCAACGGCCTCTCTGGATGCAGAAAGTCTACGTCGAC
CTCGTCAAGCCCATGATGGGTGCCGCCACGGGCACCTCCTCCGTCGAGGCACGGAGCCGGTCGATACAGACAAAC
TACGGCATTGCCGTGCTGGCCATGGTCAAGCACATGCGCTACCCCGTCTACGAGGAGGACTCCAGCACCATCATA
CGCATAGCCATCTCTACGGCACAGAAACTAGGCATCGGTCCCGACACGAGAGCTGCACTTCAGGTGATCAACAGC
GTGCTAGGCGAGGCCCCGGAGGTCGTACAGGATCACCTCGGGAGCCTCATCTCCATCTGCACTAGCGTCTTCACC
AGCGAGCCGCCGACGACGCAGACCGACGACGAGTCGCCGACGACGCAAACCGACGACGAGTCGCCGGAAGAGACG
CAGGCTGGCTGTGCCAAGCTGGCTCTTGAGATGGTCGGCCGCCTGCCGCAGACGCTGGAGTCGAGACATCTCTTG
GCCCATGCGCCTGCGGTGCGGCGACAGCTGGCTGCCGCGTGTGGACACAGGGTTCGGGACCTGAGGAGGTTGGCG
CGGCTTGCGCGGACGGCCTGGGCGGACTTGAAGTGA
Gene >Ophio5|6417
ATGGCCGACTTCCGCCAGCTCGCCCTCGATTTCATCCTGGAGGACGACGAGGCGACGTTGACGAACATCGCCCGC
CGCGCGGCATCAGGTCGGCTTCTTCCTCGGTCGCAGTCGATGATTGATGCTTATATATTATCCAGAGATCGAATC
TGCCTCCTTGGGCTCCAATCCTGTCGCTCGCTGGGTTGAGGCTGTCCAGCCGTGGATGCCGGGGAGCGACGATGA
TGCTATGCGCGATGATGGAGATATTCCGGACTGGACCACACGCGCCAAGGGTAACCTTCTGTATCGCGTCCGCGC
TCCGTCACATCTTTCTGACCCGCCCTAGCTTTGGAGTTTCTCTCTCGTACCCTGCTTCTCCTAGACCAGGGCCTT
TTGAAGCCGAGTCAAGGTATGTCGAGTCTGGTTCACTTACCAGTCATCAGCCTAATCGCCATAGTCAACCTCCTC
GTCGCCTTCTTCGGCGCCATGTTCGATGTCGACCACAAGGCCGGCATCATGGCCTCCGCCACGGCCCTTTCGCGC
ATCGTCACTATGAAGTCATTTCAGCCGTCGAGTGGCCGCAGCATTATCCAGATGGTGTGTGCTCTCAAGGATGAC
TTTCCTCGTCAAGTGGCAAAGACGCGTTTGGCAATTTACCGTCTTCTTCGTTCCATCATTACCGATGCCGCCGTT
GCCCGCGACCTCGAATCCGGCGGGGGTGATGGGGCTTTCATGTGCCGTCTGCTTCATCTCTGCCAGAACGAGAGG
GATCCGGAATGCCTGATGGTGTGGCTCGATACTCTACGCTTCTTCGCGGCCGAATATTCTTCTTCGGAAGCAGTC
CTGGACGACGTTTACGGAGCCTTCAAGGCCTACTTTCCCATCACCGTGCCTCGCGCGTCCCAGAGTGGTTTGACG
CCCGAGGAGCTCAAGCTTCAATTGCGGCGATGCTTCTCTTCTAACGGCCGTTTGGCTCCTCAAACTTTGCCCTTT
CTGCTGGAGAAGCTGGATCAGGGGGACGGTGTGACTGTCAATGTCAAGGTATGCCAATCGTCCGACGTAGCCATT
TGACCCCCTTCTCACACCTTCCAGATTGATATTCTTCGCACACTGAGGGCCTGCCTTGAGGAATACGCTCATCCC
CAGCAGTCGGTCGCGCCATTCGCTGGCAGAGTGTGGGATAGCCTCAAGTACGAGGTGCGCAATGGCGACGTTGAG
GATACCGTTTGGGCCACTCTCGAGGTGCTCAAGGCGCTCACCACGAGGTTGGAAGGCGACGCGCTGCGAGAGTTC
GCCCTGACCGTCACCCGCGAGTGCGTTGACGACCTCTCAAGCCAGGCCTACGCTGCCGCTGCTGGAAGGTTGCTC
ATCAGTGTATTGAGCGCAGATGCACGTGCCTTTGCTCTCATGGCTTCGCCGGCCGTAACGCACATCAAAGAAAAC
CTGCGGCATCCCAAGTCGTCGACGCATAAGCTCGATTTGCTCAAGATTCTGCGCATCCTTCTCGAGACGAGACTG
CTCCTCGCAGATATGCAGATGCCAGACCCGGAGAGGCAAGACTTTGGAGCCACAGACTCCGTCTTCCGGCCGCTC
TACGGCGACGTCTATCGAGGTCTGGTCGAGGCGACGGATGGAGCAGACGCTTCCTACGACGTTAAAGTGACGACC
GAAGCTGTTCAGGGCGTGGGCGCGCTCGTCTGCCAGCGGTTATCGAGGGCGGCGGCCACCGATGAGCAGCGCACC
GCAGATCTGCTACTCCCTCAAGAGATATGTGCTCAGATCTGCGACGCGCTCTTCTCCCTTGCAGCCCGGTCCTGG
GAGTTGCAGTCGCCGCAGGCCGCATCTTACGAGCTCATCAACGAGAGTATCAAGGCGCTACGACGGGCCACTGAG
GCTTATCCTCTGGGCTTCCAGCCATTGATGGAGAGAGGTCTGGCAACGATTCGGAACAGCTACGCCAGCGCCGTC
GCCGAGTCTGTCTCTACAATCCAAAGGGTGTCGTCTGTCGTCGCCTTTGTGGGATGCTCAGGGCTGAAGCCGTCT
CTGGCGCACGCCATGAGATGCTTCCTGGCTCTCACATGTGCTTTGACTTGGGAGCTTTCGGCGGCAATGGACGAC
AAGCGAGATAATCGCCTGTGGTGTGCGTTAGTGGCCGGTATCGAGACGGCCGTTCACTACTTTAAAGATGCCTTT
ACCGACGTGAGCTTAGAGGATCCCTTACAAAGGCCGCACGAAGACGAGTCGCCGTCGCCGGCCCTTTGGCTGGCA
ACCATCATGACGAGATACCCCCTATTGAGCTCGATAGATAGCGCCGACACGCCATCAGCTCTTGACATCGACACG
CTGGCGATTCCCAAAGTCGACTCTGCCTTTGCGCTTCGTGACGATTTTCTGCTCGTCAGTCTCGTCATATGCCGC
CACCTTTACCGCAGGGTCACAAAGCCGTTGGAGACGCAAGGCGAGGAGGCTATGGCCCTCGGCCTTGGGGATGAC
TTTACCGGCGCTGACCCGGAAGTTACATATCGCTATCTTTCTATGCTGTCTGACCTCGCCAGTTTCATCGTGGGA
GAGATGGGTCGATCTGGGTGTCCATCGCCGCAGATTGAAGCCTATTTCCTGACTCTATTCCGCCATGACAGCATT
GCTCTCCCGCCGGTAGGAGCTGTACAACCTCCTGGCTCGTGGCGCTGGCTGGCTACGGGACCTTTGAGTGTGCTA
TCTTGGGGCATTCTTAGGTCTATGCCTCCGGTCGGGGTTGCGCGACTGGTGAGCAATAAATCGCATCTCCAGAGC
GTATCTAAAACAGGCAAATGCTGACACAGAGTCGCCAGTACGATATTGGTGTCGCTCAGCGAATGCTGCTTGACG
GCACCTCGTCTGCTTTCCATGGTGACCACGCTGCGGACGGCCTGCCCGTTACGAGGGCCATTCTATCTGTCCTGG
CCAACAAGTACAAGCTCGAGACGGTAGATGGCGTGATGACGGCCATCGAGCAAGACGCCCAGAGCGCCCTGAAGC
AGGCGGCGATGGGATCTAGTCCAGAAGACCAACGACAGGGGCTGGACCAAGCCCTGACCATCTTTACGCTCGCGG
GCAGCCTGGCACGGCGGTCTACCGGCCACCGAACACGGGCCTTGCTGGATCTGCTACGGCCGGCGCCCGAAGATC
ACACGGCGGGCTATCGTCTGGCGAGGGGATTGGAGCTGGTCGTTGCACCCCAGACGTTCCTTACAGACAGCGTCG
GATCCGTCCAACGGCCTCTCTGGATGCAGAAAGTCTACGTCGACCTCGTCAAGCCCATGATGGGTGCCGCCACGG
GCACCTCCTCCGTCGAGGCACGGAGCCGGTCGATACAGACAAACTACGGCATTGCCGTGCTGGCCATGGTCAAGC
ACATGCGCTACCCCGTCTACGAGGAGGACTCCAGCACCATCATACGCATAGCCATCTCTACGGCACAGAAACTAG
GCATCGGTCCCGACACGAGAGCTGCACTTCAGGTGATCAACAGCGTGCTAGGCGAGGCCCCGGAGGTCGTACAGG
ATCACCTCGGGAGCCTCATCTCCATCTGCACTAGCGTCTTCACCAGCGAGCCGCCGACGACGCAGACCGACGACG
AGTCGCCGACGACGCAAACCGACGACGAGTCGCCGGAAGAGACGCAGGCTGGCTGTGCCAAGCTGGCTCTTGAGA
TGGTCGGCCGCCTGCCGCAGACGCTGGAGTCGAGACATCTCTTGGCCCATGCGCCTGCGGTGCGGCGACAGCTGG
CTGCCGCGTGTGGACACAGGGTTCGGGACCTGAGGAGGTTGGCGCGGCTTGCGCGGACGGCCTGGGCGGACTTGA
AGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail