Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|6414
Gene name
Locationscaffold_56:29186..30812
Strand+
Gene length (bp)1626
Transcript length (bp)1569
Coding sequence length (bp)1566
Protein length (aa) 522

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

(None)

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Endoplasmic reticulum 0.4546 0.1727 0.0637 0.1198 0.4793 0.0914 0.7001 0.1605 0.4531 0.1455

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup296
Change Orthofinder run
Species Protein ID
Ophiocordyceps camponoti-floridani Ophcf2|00022
Ophiocordyceps camponoti-floridani Ophcf2|01596
Ophiocordyceps camponoti-floridani Ophcf2|06712
Ophiocordyceps camponoti-rufipedis Ophun1|1283
Ophiocordyceps camponoti-rufipedis Ophun1|2810
Ophiocordyceps camponoti-rufipedis Ophun1|950
Ophiocordyceps kimflemingae Ophio5|2947
Ophiocordyceps kimflemingae Ophio5|4080
Ophiocordyceps kimflemingae Ophio5|6414 (this protein)
Ophiocordyceps subramaniannii Hirsu2|9518

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|6414
MPFDVLRRLFVHAPAAGRRPVDTSDDEVYPIHTLDGREGTQNLLLSWMLRFDDVLDAQMLYRSLCRLIELGDWRK
LGGRYRRNQASCHESSQHGKLELHVPKQFTLQRPAVNYSHGLNLEMAMEKDAVGQHLPRQADRPYFQSSHVDFMP
LMGPANMPTTLEQMTDRDMPQLQLHIESFQDGTLVTVSFPHVLMDGIGFKSVLTAWSLVLAGREQDVPAVHGAKT
DVLQSACIDEDQKGEELVLKAVILRRLNRFLFYSRLLLDRWMNPEPQRRIIFLPAAVVNQLKWQAQQDIMDEGGP
IDHQTPIISTGDVLLAWAIRLITSSESGPHRPVTAISAFNARFTLPELNLPAVAYPQNMFLETFTLLSAPKDGSS
AHGSLGRIALAHRLQVAKQTTAEQTRSQVRAKYQPRARLEFYGPDKALPIVFNNVSKANVLQTVNFGPAVLAARQ
AEPRRPGSGSAVYHHFCVLKRRESNFRNVFAVFGKDLEGNYWMTAALAPWTWDKLQDEFDNLPSASGKVAAM
Coding >Ophio5|6414
ATGCCCTTCGACGTCCTACGTCGACTGTTTGTCCACGCACCGGCTGCCGGCCGCCGCCCAGTCGACACGTCCGAC
GATGAAGTGTACCCTATACACACGCTGGACGGGAGAGAAGGGACGCAGAACTTACTGCTGAGTTGGATGCTGCGA
TTCGATGATGTGCTCGACGCCCAGATGCTGTACCGCTCTCTCTGCAGGCTCATCGAGCTGGGCGACTGGAGGAAG
CTCGGCGGTCGTTACCGACGCAACCAGGCAAGTTGTCACGAGAGTTCTCAGCATGGCAAGTTGGAGCTGCACGTA
CCCAAGCAATTCACTCTCCAGCGTCCGGCCGTCAACTATAGCCATGGCCTGAATCTCGAGATGGCGATGGAGAAA
GACGCGGTAGGGCAACACCTGCCCAGACAAGCAGACAGGCCGTATTTTCAATCGAGCCATGTCGACTTCATGCCC
CTGATGGGACCGGCGAATATGCCCACGACGCTGGAGCAGATGACGGACCGAGACATGCCGCAGCTACAACTGCAC
ATTGAGTCTTTCCAGGATGGCACACTCGTGACAGTGTCGTTTCCTCACGTCTTGATGGATGGCATTGGTTTCAAG
TCGGTTCTGACCGCCTGGTCACTCGTCTTGGCTGGTCGAGAGCAAGACGTGCCGGCAGTGCATGGTGCCAAGACG
GATGTCTTGCAGTCGGCCTGTATAGACGAGGATCAGAAGGGAGAAGAGCTGGTTCTGAAAGCGGTGATACTCAGA
CGCCTGAACAGGTTTCTCTTCTACTCACGTCTCTTACTCGACCGATGGATGAATCCCGAACCGCAGAGACGAATC
ATCTTTCTCCCCGCCGCCGTCGTCAACCAACTGAAATGGCAAGCACAACAAGACATCATGGACGAAGGCGGTCCC
ATCGACCACCAGACGCCCATCATCAGCACGGGAGACGTGCTTCTCGCCTGGGCAATCCGTCTCATCACCTCGTCC
GAGTCCGGACCCCATCGACCCGTCACCGCCATAAGCGCCTTCAACGCTCGTTTCACTCTACCGGAACTCAACCTG
CCAGCTGTCGCCTATCCCCAAAACATGTTTCTCGAAACCTTCACTCTGCTATCTGCACCAAAAGACGGATCGTCC
GCTCATGGTTCCCTAGGAAGAATAGCCCTCGCCCATCGCCTCCAGGTAGCGAAGCAGACGACGGCGGAACAGACG
CGGAGCCAAGTGCGAGCCAAATACCAGCCCAGGGCCCGACTCGAGTTCTACGGACCAGACAAGGCGTTGCCCATC
GTCTTCAACAACGTTTCCAAGGCCAATGTGCTTCAGACGGTCAACTTCGGACCCGCTGTCCTGGCTGCAAGACAA
GCAGAACCACGTCGCCCGGGGTCGGGATCCGCCGTCTATCACCATTTTTGTGTTTTGAAGCGCCGTGAATCGAAC
TTTCGAAATGTTTTTGCCGTCTTTGGTAAGGATCTCGAGGGTAACTATTGGATGACGGCTGCTCTGGCGCCTTGG
ACGTGGGACAAGCTCCAAGACGAGTTTGACAATCTACCGTCGGCTTCGGGAAAGGTTGCTGCTATG
Transcript >Ophio5|6414
ATGCCCTTCGACGTCCTACGTCGACTGTTTGTCCACGCACCGGCTGCCGGCCGCCGCCCAGTCGACACGTCCGAC
GATGAAGTGTACCCTATACACACGCTGGACGGGAGAGAAGGGACGCAGAACTTACTGCTGAGTTGGATGCTGCGA
TTCGATGATGTGCTCGACGCCCAGATGCTGTACCGCTCTCTCTGCAGGCTCATCGAGCTGGGCGACTGGAGGAAG
CTCGGCGGTCGTTACCGACGCAACCAGGCAAGTTGTCACGAGAGTTCTCAGCATGGCAAGTTGGAGCTGCACGTA
CCCAAGCAATTCACTCTCCAGCGTCCGGCCGTCAACTATAGCCATGGCCTGAATCTCGAGATGGCGATGGAGAAA
GACGCGGTAGGGCAACACCTGCCCAGACAAGCAGACAGGCCGTATTTTCAATCGAGCCATGTCGACTTCATGCCC
CTGATGGGACCGGCGAATATGCCCACGACGCTGGAGCAGATGACGGACCGAGACATGCCGCAGCTACAACTGCAC
ATTGAGTCTTTCCAGGATGGCACACTCGTGACAGTGTCGTTTCCTCACGTCTTGATGGATGGCATTGGTTTCAAG
TCGGTTCTGACCGCCTGGTCACTCGTCTTGGCTGGTCGAGAGCAAGACGTGCCGGCAGTGCATGGTGCCAAGACG
GATGTCTTGCAGTCGGCCTGTATAGACGAGGATCAGAAGGGAGAAGAGCTGGTTCTGAAAGCGGTGATACTCAGA
CGCCTGAACAGGTTTCTCTTCTACTCACGTCTCTTACTCGACCGATGGATGAATCCCGAACCGCAGAGACGAATC
ATCTTTCTCCCCGCCGCCGTCGTCAACCAACTGAAATGGCAAGCACAACAAGACATCATGGACGAAGGCGGTCCC
ATCGACCACCAGACGCCCATCATCAGCACGGGAGACGTGCTTCTCGCCTGGGCAATCCGTCTCATCACCTCGTCC
GAGTCCGGACCCCATCGACCCGTCACCGCCATAAGCGCCTTCAACGCTCGTTTCACTCTACCGGAACTCAACCTG
CCAGCTGTCGCCTATCCCCAAAACATGTTTCTCGAAACCTTCACTCTGCTATCTGCACCAAAAGACGGATCGTCC
GCTCATGGTTCCCTAGGAAGAATAGCCCTCGCCCATCGCCTCCAGGTAGCGAAGCAGACGACGGCGGAACAGACG
CGGAGCCAAGTGCGAGCCAAATACCAGCCCAGGGCCCGACTCGAGTTCTACGGACCAGACAAGGCGTTGCCCATC
GTCTTCAACAACGTTTCCAAGGCCAATGTGCTTCAGACGGTCAACTTCGGACCCGCTGTCCTGGCTGCAAGACAA
GCAGAACCACGTCGCCCGGGGTCGGGATCCGCCGTCTATCACCATTTTTGTGTTTTGAAGCGCCGTGAATCGAAC
TTTCGAAATGTTTTTGCCGTCTTTGGTAAGGATCTCGAGGGTAACTATTGGATGACGGCTGCTCTGGCGCCTTGG
ACGTGGGACAAGCTCCAAGACGAGTTTGACAATCTACCGTCGGCTTCGGGAAAGGTTGCTGCTATGTGA
Gene >Ophio5|6414
ATGCCCTTCGACGTCCTACGTCGACTGTTTGTCCACGCACCGGCTGCCGGCCGCCGCCCAGTCGACACGTCCGAC
GATGAAGTGTACCCTATACACACGCTGGACGGGAGAGAAGGGACGCAGAACTTACTGCTGAGTTGGATGCTGCGA
TTCGATGATGTGCTCGACGCCCAGATGCTGTACCGCTCTCTCTGCAGGCTCATCGAGCTGGGCGACTGGAGGAAG
CTCGGCGGTCGTTACCGACGCAACCAGGCAAGTTGTCACGAGAGGTCGATTGGGAAAAAAAAAAAAAAAGAAGCG
GCAGTGTGCTGACTCGAGGCTGTGAGTTCTCAGCATGGCAAGTTGGAGCTGCACGTACCCAAGCAATTCACTCTC
CAGCGTCCGGCCGTCAACTATAGCCATGGCCTGAATCTCGAGATGGCGATGGAGAAAGACGCGGTAGGGCAACAC
CTGCCCAGACAAGCAGACAGGCCGTATTTTCAATCGAGCCATGTCGACTTCATGCCCCTGATGGGACCGGCGAAT
ATGCCCACGACGCTGGAGCAGATGACGGACCGAGACATGCCGCAGCTACAACTGCACATTGAGTCTTTCCAGGAT
GGCACACTCGTGACAGTGTCGTTTCCTCACGTCTTGATGGATGGCATTGGTTTCAAGTCGGTTCTGACCGCCTGG
TCACTCGTCTTGGCTGGTCGAGAGCAAGACGTGCCGGCAGTGCATGGTGCCAAGACGGATGTCTTGCAGTCGGCC
TGTATAGACGAGGATCAGAAGGGAGAAGAGCTGGTTCTGAAAGCGGTGATACTCAGACGCCTGAACAGGTTTCTC
TTCTACTCACGTCTCTTACTCGACCGATGGATGAATCCCGAACCGCAGAGACGAATCATCTTTCTCCCCGCCGCC
GTCGTCAACCAACTGAAATGGCAAGCACAACAAGACATCATGGACGAAGGCGGTCCCATCGACCACCAGACGCCC
ATCATCAGCACGGGAGACGTGCTTCTCGCCTGGGCAATCCGTCTCATCACCTCGTCCGAGTCCGGACCCCATCGA
CCCGTCACCGCCATAAGCGCCTTCAACGCTCGTTTCACTCTACCGGAACTCAACCTGCCAGCTGTCGCCTATCCC
CAAAACATGTTTCTCGAAACCTTCACTCTGCTATCTGCACCAAAAGACGGATCGTCCGCTCATGGTTCCCTAGGA
AGAATAGCCCTCGCCCATCGCCTCCAGGTAGCGAAGCAGACGACGGCGGAACAGACGCGGAGCCAAGTGCGAGCC
AAATACCAGCCCAGGGCCCGACTCGAGTTCTACGGACCAGACAAGGCGTTGCCCATCGTCTTCAACAACGTTTCC
AAGGCCAATGTGCTTCAGACGGTCAACTTCGGACCCGCTGTCCTGGCTGCAAGACAAGCAGAACCACGTCGCCCG
GGGTCGGGATCCGCCGTCTATCACCATTTTTGTGTTTTGAAGCGCCGTGAATCGAACTTTCGAAATGTTTTTGCC
GTCTTTGGTAAGGATCTCGAGGGTAACTATTGGATGACGGCTGCTCTGGCGCCTTGGACGTGGGACAAGCTCCAA
GACGAGTTTGACAATCTACCGTCGGCTTCGGGAAAGGTTGCTGCTATGTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail