Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|6411
Gene name
Locationscaffold_56:23269..25284
Strand-
Gene length (bp)2015
Transcript length (bp)1902
Coding sequence length (bp)1899
Protein length (aa) 633

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF10453 NUFIP1 Nuclear fragile X mental retardation-interacting protein 1 (NUFIP1) 1.5E-08 365 396

Swissprot hits

(None)

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Nucleus Nuclear localization signal 0.2316 0.8519 0.0417 0.0037 0.0534 0.0076 0.0664 0.0145 0.0191 0.007

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup2783
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|1053
Ophiocordyceps australis map64 (Brazil) OphauB2|7182
Ophiocordyceps camponoti-floridani Ophcf2|06410
Ophiocordyceps camponoti-rufipedis Ophun1|3490
Ophiocordyceps kimflemingae Ophio5|6411 (this protein)
Ophiocordyceps subramaniannii Hirsu2|4443

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|6411
MLVRFSSDPESRISASPFPAAAAALRLAASPAIMSSYGYGPPPPPPPPPSLSASYGHHGHYRGGGPSVGRGRGGQ
YSRGRGDFHAAPAPPIHYEYGSQPYNYSVSHSPAMPYPPHPQQWPPEHVPPPSNSHSHAPTPISPSNYHPNYASH
YPPSQYSPQPPYGPPQQYGSPYQAAHPPAAPPHWNPLGSAQQGHYTTGGRGARAGSKHPHASRQGYEHEPPAPVG
GGSYAQPYSHDPRASHYPPPQYAYAGPPPPPPTHVHHEANHGQYHRRGRGGGYRDGSRGRGGHHHGSSHSAGDRA
RHQQRQGPASEVKVKMESPSVGKKKKRKTNTLGLTPGMDSESEDDEGEEKALVDLIGPETLHIADIAAFLAERRK
NYPTKARVEAKKAAELARKDEDKAASLEKQADRLRRQLRKVESSIKRKREQGDEGDEMRDSSEESSDEEKPEVLS
SRIITAADLDASAKKADVSRHCKYFSTGGTCGKKGKCRFVHDHEVRAAAIKEREANDGRMTIQQRLILNDKEQED
LTILQSIQYLREKGLMEPAPQPQASSDKADRSRSVKMERPEKPAPAISSLLPAAPASLPEPPIKREVSSSRRNAP
TPVASSGLEHYQGWLLQPYGSTNGKQSVGDDLP
Coding >Ophio5|6411
ATGCTCGTCAGATTCTCTTCCGATCCCGAGTCACGCATCTCTGCCTCTCCTTTCCCTGCAGCCGCTGCCGCTCTC
CGTTTGGCGGCCTCCCCTGCAATCATGTCTAGCTACGGCTACGGCCCTCCGCCTCCTCCTCCGCCACCGCCCTCT
CTGTCTGCTTCCTACGGCCATCACGGCCATTATCGCGGCGGCGGACCCTCAGTCGGACGCGGCCGAGGCGGGCAA
TATTCTCGTGGTCGAGGTGATTTTCACGCTGCACCGGCTCCTCCGATTCATTACGAATACGGAAGCCAGCCCTAC
AACTACTCTGTTTCGCACTCCCCCGCCATGCCCTATCCGCCTCATCCACAGCAGTGGCCGCCCGAGCACGTTCCG
CCCCCCTCCAACTCCCATTCCCATGCTCCCACTCCCATCTCCCCTTCAAATTACCATCCCAACTACGCGTCTCAC
TACCCGCCCTCTCAATACTCTCCGCAGCCGCCTTACGGTCCGCCCCAGCAGTATGGGAGCCCGTACCAGGCCGCT
CATCCTCCGGCTGCGCCCCCACATTGGAACCCTCTCGGCTCGGCACAGCAGGGACACTACACCACCGGCGGAAGA
GGAGCTCGGGCCGGTTCCAAGCATCCTCATGCCTCGCGTCAGGGCTACGAGCACGAGCCGCCCGCCCCAGTTGGT
GGTGGCAGCTACGCACAGCCATATTCCCATGACCCCCGTGCTTCCCATTATCCCCCTCCCCAGTATGCCTATGCC
GGACCGCCCCCCCCTCCCCCAACCCACGTTCACCATGAGGCCAATCATGGTCAGTACCATCGCCGTGGCCGAGGT
GGTGGGTATAGAGACGGATCGCGCGGACGAGGAGGCCACCATCACGGCAGCAGCCACTCGGCCGGAGATAGGGCA
CGCCATCAGCAGCGCCAGGGCCCCGCGTCCGAGGTCAAGGTCAAGATGGAATCGCCGTCCGTGGGAAAGAAGAAG
AAGCGCAAGACGAACACGCTCGGCCTGACTCCCGGCATGGACTCGGAATCGGAAGACGATGAGGGAGAAGAGAAA
GCTCTCGTGGACCTGATCGGGCCCGAGACGCTACACATCGCCGATATCGCTGCATTTTTGGCCGAGCGGCGGAAG
AACTACCCCACCAAGGCGCGCGTCGAGGCCAAGAAGGCTGCCGAGCTGGCACGGAAGGACGAGGACAAGGCCGCC
TCGTTGGAGAAGCAGGCCGACCGGCTTCGACGGCAGCTTCGAAAAGTCGAGTCGTCCATCAAGCGCAAACGAGAG
CAGGGCGACGAGGGCGACGAAATGAGAGACTCGTCGGAAGAGTCGTCCGACGAAGAGAAGCCCGAAGTCCTGTCT
TCTCGCATCATCACGGCCGCGGACCTCGACGCCTCGGCTAAGAAGGCCGACGTCTCCAGACACTGCAAATACTTT
TCCACTGGCGGGACCTGCGGCAAGAAGGGCAAGTGCCGCTTCGTCCATGATCACGAGGTCAGAGCGGCGGCCATC
AAGGAGCGAGAGGCCAACGACGGCCGTATGACGATCCAGCAACGGCTCATCCTGAACGACAAGGAGCAGGAGGAC
CTGACCATTCTCCAGTCCATCCAGTACCTGCGCGAGAAGGGACTCATGGAGCCGGCGCCCCAGCCCCAGGCGAGC
AGCGACAAGGCCGACAGGAGCCGCTCAGTCAAGATGGAGAGGCCCGAGAAGCCCGCGCCCGCCATTTCGAGTCTG
CTGCCTGCGGCCCCGGCCTCGCTGCCCGAGCCGCCGATCAAGAGGGAGGTCAGCTCGAGCCGTCGAAACGCCCCG
ACGCCCGTCGCGAGTTCGGGACTGGAGCACTACCAGGGCTGGCTGCTGCAGCCGTATGGCAGCACCAACGGGAAG
CAGTCGGTGGGCGATGATTTGCCA
Transcript >Ophio5|6411
ATGCTCGTCAGATTCTCTTCCGATCCCGAGTCACGCATCTCTGCCTCTCCTTTCCCTGCAGCCGCTGCCGCTCTC
CGTTTGGCGGCCTCCCCTGCAATCATGTCTAGCTACGGCTACGGCCCTCCGCCTCCTCCTCCGCCACCGCCCTCT
CTGTCTGCTTCCTACGGCCATCACGGCCATTATCGCGGCGGCGGACCCTCAGTCGGACGCGGCCGAGGCGGGCAA
TATTCTCGTGGTCGAGGTGATTTTCACGCTGCACCGGCTCCTCCGATTCATTACGAATACGGAAGCCAGCCCTAC
AACTACTCTGTTTCGCACTCCCCCGCCATGCCCTATCCGCCTCATCCACAGCAGTGGCCGCCCGAGCACGTTCCG
CCCCCCTCCAACTCCCATTCCCATGCTCCCACTCCCATCTCCCCTTCAAATTACCATCCCAACTACGCGTCTCAC
TACCCGCCCTCTCAATACTCTCCGCAGCCGCCTTACGGTCCGCCCCAGCAGTATGGGAGCCCGTACCAGGCCGCT
CATCCTCCGGCTGCGCCCCCACATTGGAACCCTCTCGGCTCGGCACAGCAGGGACACTACACCACCGGCGGAAGA
GGAGCTCGGGCCGGTTCCAAGCATCCTCATGCCTCGCGTCAGGGCTACGAGCACGAGCCGCCCGCCCCAGTTGGT
GGTGGCAGCTACGCACAGCCATATTCCCATGACCCCCGTGCTTCCCATTATCCCCCTCCCCAGTATGCCTATGCC
GGACCGCCCCCCCCTCCCCCAACCCACGTTCACCATGAGGCCAATCATGGTCAGTACCATCGCCGTGGCCGAGGT
GGTGGGTATAGAGACGGATCGCGCGGACGAGGAGGCCACCATCACGGCAGCAGCCACTCGGCCGGAGATAGGGCA
CGCCATCAGCAGCGCCAGGGCCCCGCGTCCGAGGTCAAGGTCAAGATGGAATCGCCGTCCGTGGGAAAGAAGAAG
AAGCGCAAGACGAACACGCTCGGCCTGACTCCCGGCATGGACTCGGAATCGGAAGACGATGAGGGAGAAGAGAAA
GCTCTCGTGGACCTGATCGGGCCCGAGACGCTACACATCGCCGATATCGCTGCATTTTTGGCCGAGCGGCGGAAG
AACTACCCCACCAAGGCGCGCGTCGAGGCCAAGAAGGCTGCCGAGCTGGCACGGAAGGACGAGGACAAGGCCGCC
TCGTTGGAGAAGCAGGCCGACCGGCTTCGACGGCAGCTTCGAAAAGTCGAGTCGTCCATCAAGCGCAAACGAGAG
CAGGGCGACGAGGGCGACGAAATGAGAGACTCGTCGGAAGAGTCGTCCGACGAAGAGAAGCCCGAAGTCCTGTCT
TCTCGCATCATCACGGCCGCGGACCTCGACGCCTCGGCTAAGAAGGCCGACGTCTCCAGACACTGCAAATACTTT
TCCACTGGCGGGACCTGCGGCAAGAAGGGCAAGTGCCGCTTCGTCCATGATCACGAGGTCAGAGCGGCGGCCATC
AAGGAGCGAGAGGCCAACGACGGCCGTATGACGATCCAGCAACGGCTCATCCTGAACGACAAGGAGCAGGAGGAC
CTGACCATTCTCCAGTCCATCCAGTACCTGCGCGAGAAGGGACTCATGGAGCCGGCGCCCCAGCCCCAGGCGAGC
AGCGACAAGGCCGACAGGAGCCGCTCAGTCAAGATGGAGAGGCCCGAGAAGCCCGCGCCCGCCATTTCGAGTCTG
CTGCCTGCGGCCCCGGCCTCGCTGCCCGAGCCGCCGATCAAGAGGGAGGTCAGCTCGAGCCGTCGAAACGCCCCG
ACGCCCGTCGCGAGTTCGGGACTGGAGCACTACCAGGGCTGGCTGCTGCAGCCGTATGGCAGCACCAACGGGAAG
CAGTCGGTGGGCGATGATTTGCCATGA
Gene >Ophio5|6411
ATGCTCGTCAGATTCTCTTCCGATCCCGAGTCACGCATCTCTGCCTCTCCTTTCCCTGCAGCCGCTGCCGCTCTC
CGTTTGGCGGCCTCCCGTGTGCACAAGCAAAATTCTTTGCCCTACGCGTCTCCGTCAAGCTAAAAGCATCTGCAG
CTGCAATCATGTCTAGCTACGGCTACGGCCCTCCGCCTCCTCCTCCGCCACCGCCCTCTCTGTCTGCTTCCTACG
GCCATCACGGCCATTATCGCGGCGGCGGACCCTCAGTCGGACGCGGCCGAGGCGGGCAATATTCTCGTGGTCGAG
GTGATTTTCACGCTGCACCGGCTCCTCCGATTCATTACGAATACGGAAGCCAGCCCTACAACTACTCTGTTTCGC
ACTCCCCCGCCATGCCCTATCCGCCTCATCCACAGCAGTGGCCGCCCGAGCACGTTCCGCCCCCCTCCAACTCCC
ATTCCCATGCTCCCACTCCCATCTCCCCTTCAAATTACCATCCCAACTACGCGTCTCACTACCCGCCCTCTCAAT
ACTCTCCGCAGCCGCCTTACGGTCCGCCCCAGCAGTATGGGAGCCCGTACCAGGCCGCTCATCCTCCGGCTGCGC
CCCCACATTGGAACCCTCTCGGCTCGGCACAGCAGGGACACTACACCACCGGCGGAAGAGGAGCTCGGGCCGGTT
CCAAGCATCCTCATGCCTCGCGTCAGGGCTACGAGCACGAGCCGCCCGCCCCAGTTGGTGGTGGCAGCTACGCAC
AGCCATATTCCCATGACCCCCGTGCTTCCCATTATCCCCCTCCCCAGTATGCCTATGCCGGACCGCCCCCCCCTC
CCCCAACCCACGTTCACCATGAGGCCAATCATGGTCAGTACCATCGCCGTGGCCGAGGTGGTGGGTATAGAGACG
GATCGCGCGGACGAGGAGGCCACCATCACGGCAGCAGCCACTCGGCCGGAGATAGGGCACGCCATCAGCAGCGCC
AGGGCCCCGCGTCCGAGGTCAAGGTCAAGATGGAATCGCCGTCCGTGGGAAAGAAGAAGAAGCGCAAGACGAACA
CGCTCGGCCTGACTCCCGGCATGGACTCGGAATCGGAAGACGATGAGGGAGAAGAGAAAGCTCTCGTGGACCTGA
TCGGGCCCGAGACGCTACAGTAAGCTGTTTCCTCCCCGGTTTCCTGCAACCTCGCCGCTGACTGGCAGTACAGCA
TCGCCGATATCGCTGCATTTTTGGCCGAGCGGCGGAAGAACTACCCCACCAAGGCGCGCGTCGAGGCCAAGAAGG
CTGCCGAGCTGGCACGGAAGGACGAGGACAAGGCCGCCTCGTTGGAGAAGCAGGCCGACCGGCTTCGACGGCAGC
TTCGAAAAGTCGAGTCGTCCATCAAGCGCAAACGAGAGCAGGGCGACGAGGGCGACGAAATGAGAGACTCGTCGG
AAGAGTCGTCCGACGAAGAGAAGCCCGAAGTCCTGTCTTCTCGCATCATCACGGCCGCGGACCTCGACGCCTCGG
CTAAGAAGGCCGACGTCTCCAGACACTGCAAATACTTTTCCACTGGCGGGACCTGCGGCAAGAAGGGCAAGTGCC
GCTTCGTCCATGATCACGAGGTCAGAGCGGCGGCCATCAAGGAGCGAGAGGCCAACGACGGCCGTATGACGATCC
AGCAACGGCTCATCCTGAACGACAAGGAGCAGGAGGACCTGACCATTCTCCAGTCCATCCAGTACCTGCGCGAGA
AGGGACTCATGGAGCCGGCGCCCCAGCCCCAGGCGAGCAGCGACAAGGCCGACAGGAGCCGCTCAGTCAAGATGG
AGAGGCCCGAGAAGCCCGCGCCCGCCATTTCGAGTCTGCTGCCTGCGGCCCCGGCCTCGCTGCCCGAGCCGCCGA
TCAAGAGGGAGGTCAGCTCGAGCCGTCGAAACGCCCCGACGCCCGTCGCGAGTTCGGGACTGGAGCACTACCAGG
GCTGGCTGCTGCAGCCGTATGGCAGCACCAACGGGAAGCAGTCGGTGGGCGATGATTTGCCATGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail