Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|6404
Gene name
Locationscaffold_56:9174..10346
Strand-
Gene length (bp)1172
Transcript length (bp)1107
Coding sequence length (bp)1104
Protein length (aa) 368

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF07228 SpoIIE Stage II sporulation protein E (SpoIIE) 4.7E-10 108 274

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q5U3N5|PPTC7_DANRE Protein phosphatase PTC7 homolog OS=Danio rerio GN=pptc7 PE=2 SV=1 83 363 1.0E-33
sp|Q8NI37|PPTC7_HUMAN Protein phosphatase PTC7 homolog OS=Homo sapiens GN=PPTC7 PE=2 SV=1 83 363 6.0E-33
sp|Q6NVE9|PPTC7_MOUSE Protein phosphatase PTC7 homolog OS=Mus musculus GN=Pptc7 PE=1 SV=1 83 363 6.0E-33
sp|Q6GR25|PPTC7_XENLA Protein phosphatase PTC7 homolog OS=Xenopus laevis GN=pptc7 PE=2 SV=1 84 363 2.0E-32
sp|B4R089|PTC71_DROSI Protein phosphatase PTC7 homolog fig OS=Drosophila simulans GN=fig PE=3 SV=1 95 361 1.0E-30
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q5U3N5|PPTC7_DANRE Protein phosphatase PTC7 homolog OS=Danio rerio GN=pptc7 PE=2 SV=1 83 363 1.0E-33
sp|Q8NI37|PPTC7_HUMAN Protein phosphatase PTC7 homolog OS=Homo sapiens GN=PPTC7 PE=2 SV=1 83 363 6.0E-33
sp|Q6NVE9|PPTC7_MOUSE Protein phosphatase PTC7 homolog OS=Mus musculus GN=Pptc7 PE=1 SV=1 83 363 6.0E-33
sp|Q6GR25|PPTC7_XENLA Protein phosphatase PTC7 homolog OS=Xenopus laevis GN=pptc7 PE=2 SV=1 84 363 2.0E-32
sp|B4R089|PTC71_DROSI Protein phosphatase PTC7 homolog fig OS=Drosophila simulans GN=fig PE=3 SV=1 95 361 1.0E-30
sp|B4HZE7|PTC71_DROSE Protein phosphatase PTC7 homolog fig OS=Drosophila sechellia GN=fig PE=3 SV=1 95 361 9.0E-30
sp|Q9VAH4|PTC71_DROME Protein phosphatase PTC7 homolog fig OS=Drosophila melanogaster GN=fig PE=2 SV=1 95 361 1.0E-29
sp|B4PPK3|PTC71_DROYA Protein phosphatase PTC7 homolog fig OS=Drosophila yakuba GN=fig PE=3 SV=1 95 361 3.0E-29
sp|B3P5D3|PTC71_DROER Protein phosphatase PTC7 homolog fig OS=Drosophila erecta GN=fig PE=3 SV=1 95 361 9.0E-29
sp|B4M5T5|PTC71_DROVI Protein phosphatase PTC7 homolog fig OS=Drosophila virilis GN=fig PE=3 SV=1 95 359 1.0E-28
sp|B4K616|PTC71_DROMO Protein phosphatase PTC7 homolog fig OS=Drosophila mojavensis GN=fig PE=3 SV=1 95 361 2.0E-27
sp|B4JYN1|PTC71_DROGR Protein phosphatase PTC7 homolog fig OS=Drosophila grimshawi GN=fig PE=3 SV=1 95 361 6.0E-27
sp|Q29AP0|PTC71_DROPS Protein phosphatase PTC7 homolog fig OS=Drosophila pseudoobscura pseudoobscura GN=fig PE=3 SV=2 95 361 1.0E-26
sp|B4NBL6|PTC71_DROWI Protein phosphatase PTC7 homolog fig OS=Drosophila willistoni GN=fig PE=3 SV=1 95 362 1.0E-25
sp|P38797|PP2C7_YEAST Protein phosphatase 2C homolog 7, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PTC7 PE=1 SV=2 57 358 1.0E-24
sp|Q9SUK9|P2C55_ARATH Probable protein phosphatase 2C 55 OS=Arabidopsis thaliana GN=At4g16580 PE=2 SV=2 95 361 3.0E-24
sp|Q09189|AZR1_SCHPO 5-azacytidine resistance protein azr1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=azr1 PE=3 SV=3 88 361 3.0E-24
sp|B3MTI8|PTC71_DROAN Protein phosphatase PTC7 homolog fig OS=Drosophila ananassae GN=fig PE=3 SV=1 95 361 3.0E-24
sp|O64730|P2C26_ARATH Probable protein phosphatase 2C 26 OS=Arabidopsis thaliana GN=At2g30170 PE=2 SV=2 95 362 1.0E-23
sp|B4G653|PTC71_DROPE Protein phosphatase PTC7 homolog fig OS=Drosophila persimilis GN=fig PE=3 SV=1 81 361 3.0E-21
sp|Q9LVQ8|P2C80_ARATH Probable protein phosphatase 2C 80 OS=Arabidopsis thaliana GN=At5g66720 PE=2 SV=1 89 361 4.0E-20
sp|Q942P9|P2C01_ORYSJ Probable protein phosphatase 2C 1 OS=Oryza sativa subsp. japonica GN=Os01g0164600 PE=2 SV=1 89 275 1.0E-17
sp|Q6H7J4|P2C23_ORYSJ Putative protein phosphatase 2C 23 OS=Oryza sativa subsp. japonica GN=Os02g0633700 PE=5 SV=1 93 362 3.0E-17
sp|Q6H7J3|P2C24_ORYSJ Putative protein phosphatase 2C 24 OS=Oryza sativa subsp. japonica GN=Os02g0633900 PE=3 SV=1 93 361 7.0E-14
sp|Q339D2|P2C71_ORYSJ Probable protein phosphatase 2C 71 OS=Oryza sativa subsp. japonica GN=Os10g0370000 PE=2 SV=1 95 361 9.0E-14
sp|Q93V88|P2C62_ARATH Probable protein phosphatase 2C 62 OS=Arabidopsis thaliana GN=At4g33500 PE=2 SV=1 96 273 4.0E-12
sp|Q10QL5|BIP2C_ORYSJ Probable protein phosphatase 2C BIPP2C1 OS=Oryza sativa subsp. japonica GN=BIPP2C1 PE=2 SV=1 92 269 4.0E-12
sp|Q6J2K6|BIP2C_ORYSI Probable protein phosphatase 2C BIPP2C1 OS=Oryza sativa subsp. indica GN=BIPP2C1 PE=2 SV=1 92 269 5.0E-12
[Show less]

GO

GO Term Description Terminal node
GO:0004722 protein serine/threonine phosphatase activity Yes
GO:0004721 phosphoprotein phosphatase activity No
GO:0016791 phosphatase activity No
GO:0016787 hydrolase activity No
GO:0140096 catalytic activity, acting on a protein No
GO:0003824 catalytic activity No
GO:0042578 phosphoric ester hydrolase activity No
GO:0003674 molecular_function No
GO:0016788 hydrolase activity, acting on ester bonds No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 18 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|6404
MAASMAVRLILWRPWLSWTLRRPNCALSASHSTAASAPASFEEPEPTAVKNPATSRFTYHLGAAFVSKDGNEGHF
YHGGRPQLRDALTREQLDSGEDAFFISTIGDAGHHSFGVADGVGGCKSDDVDPADFSRGICDSMARFCSHGKLIT
PSRLMQMGYDAVCRQKKAQGGSSTACVAVADPSGVVEVANLGDSGFLHLRPNAIIYRSKGQSHDFNTPYQLRCPK
PSSNVLVLGDRPDDADVVYHSVRHGDILILATDGLLDNQYGHDILRKVNHVMLSSGAWQPTQSRGLGVSDNLRSL
IDMGSGCPLHTELARVLTRSARTASLSNVDGPFAKKVQQHDPAAHYFGGKQDDITVVVGIVCDEAVAG
Coding >Ophio5|6404
ATGGCTGCGTCTATGGCCGTCAGGCTTATTCTCTGGCGGCCTTGGTTGTCCTGGACACTGCGTCGACCCAATTGC
GCCCTGTCCGCTTCGCACTCGACTGCGGCCTCTGCCCCGGCCTCGTTTGAGGAACCAGAACCGACGGCTGTCAAA
AATCCCGCGACATCCAGGTTCACCTATCACCTGGGCGCCGCCTTCGTCTCCAAAGACGGAAACGAGGGTCATTTC
TATCACGGGGGCCGGCCTCAGCTCCGGGATGCACTCACTAGAGAACAGCTTGATTCCGGTGAGGATGCCTTCTTC
ATAAGCACCATCGGCGATGCCGGCCACCATTCCTTCGGCGTCGCTGATGGTGTCGGCGGCTGTAAGAGCGACGAC
GTCGATCCCGCCGACTTTTCTCGGGGCATATGTGACTCCATGGCCCGATTCTGCTCGCACGGCAAACTTATCACG
CCCTCGAGGCTGATGCAGATGGGCTACGATGCCGTGTGCCGGCAGAAAAAGGCCCAGGGCGGCAGCAGCACCGCC
TGTGTTGCCGTCGCCGACCCATCGGGCGTGGTAGAAGTGGCCAATCTCGGCGATTCGGGCTTCCTGCACCTGCGC
CCCAATGCCATCATCTACCGGTCCAAGGGCCAGAGCCACGATTTCAACACCCCTTACCAGCTGCGTTGCCCGAAG
CCGAGCAGCAACGTGTTGGTCCTCGGCGATAGGCCCGACGACGCCGACGTCGTCTATCACTCTGTTCGTCACGGT
GACATCCTCATCTTGGCCACGGACGGCCTCCTCGACAATCAGTATGGTCATGACATACTCCGCAAGGTCAACCAC
GTCATGCTGTCGAGTGGTGCCTGGCAACCGACACAGTCGAGAGGCCTTGGCGTCAGCGACAATTTGAGGAGCTTG
ATAGACATGGGATCCGGCTGCCCGCTTCATACGGAGCTGGCCAGGGTGCTGACGCGGTCAGCCAGGACGGCCAGC
CTAAGCAATGTCGACGGTCCGTTCGCCAAGAAGGTGCAGCAGCACGACCCTGCGGCCCACTACTTTGGGGGCAAG
CAGGACGACATTACCGTCGTCGTCGGCATTGTTTGCGACGAGGCTGTCGCCGGA
Transcript >Ophio5|6404
ATGGCTGCGTCTATGGCCGTCAGGCTTATTCTCTGGCGGCCTTGGTTGTCCTGGACACTGCGTCGACCCAATTGC
GCCCTGTCCGCTTCGCACTCGACTGCGGCCTCTGCCCCGGCCTCGTTTGAGGAACCAGAACCGACGGCTGTCAAA
AATCCCGCGACATCCAGGTTCACCTATCACCTGGGCGCCGCCTTCGTCTCCAAAGACGGAAACGAGGGTCATTTC
TATCACGGGGGCCGGCCTCAGCTCCGGGATGCACTCACTAGAGAACAGCTTGATTCCGGTGAGGATGCCTTCTTC
ATAAGCACCATCGGCGATGCCGGCCACCATTCCTTCGGCGTCGCTGATGGTGTCGGCGGCTGTAAGAGCGACGAC
GTCGATCCCGCCGACTTTTCTCGGGGCATATGTGACTCCATGGCCCGATTCTGCTCGCACGGCAAACTTATCACG
CCCTCGAGGCTGATGCAGATGGGCTACGATGCCGTGTGCCGGCAGAAAAAGGCCCAGGGCGGCAGCAGCACCGCC
TGTGTTGCCGTCGCCGACCCATCGGGCGTGGTAGAAGTGGCCAATCTCGGCGATTCGGGCTTCCTGCACCTGCGC
CCCAATGCCATCATCTACCGGTCCAAGGGCCAGAGCCACGATTTCAACACCCCTTACCAGCTGCGTTGCCCGAAG
CCGAGCAGCAACGTGTTGGTCCTCGGCGATAGGCCCGACGACGCCGACGTCGTCTATCACTCTGTTCGTCACGGT
GACATCCTCATCTTGGCCACGGACGGCCTCCTCGACAATCAGTATGGTCATGACATACTCCGCAAGGTCAACCAC
GTCATGCTGTCGAGTGGTGCCTGGCAACCGACACAGTCGAGAGGCCTTGGCGTCAGCGACAATTTGAGGAGCTTG
ATAGACATGGGATCCGGCTGCCCGCTTCATACGGAGCTGGCCAGGGTGCTGACGCGGTCAGCCAGGACGGCCAGC
CTAAGCAATGTCGACGGTCCGTTCGCCAAGAAGGTGCAGCAGCACGACCCTGCGGCCCACTACTTTGGGGGCAAG
CAGGACGACATTACCGTCGTCGTCGGCATTGTTTGCGACGAGGCTGTCGCCGGATAG
Gene >Ophio5|6404
ATGGCTGCGTCTATGGCCGTCAGGCTTATTCTCTGGCGGCCTTGGTTGTGTGAGTAATTCTTCCTGTCTGTGCCG
TTCCCTTGCCCCGAGAGTGTTAATGGGAATATTCATCAGCCTGGACACTGCGTCGACCCAATTGCGCCCTGTCCG
CTTCGCACTCGACTGCGGCCTCTGCCCCGGCCTCGTTTGAGGAACCAGAACCGACGGCTGTCAAAAATCCCGCGA
CATCCAGGTTCACCTATCACCTGGGCGCCGCCTTCGTCTCCAAAGACGGAAACGAGGGTCATTTCTATCACGGGG
GCCGGCCTCAGCTCCGGGATGCACTCACTAGAGAACAGCTTGATTCCGGTGAGGATGCCTTCTTCATAAGCACCA
TCGGCGATGCCGGCCACCATTCCTTCGGCGTCGCTGATGGTGTCGGCGGCTGTAAGAGCGACGACGTCGATCCCG
CCGACTTTTCTCGGGGCATATGTGACTCCATGGCCCGATTCTGCTCGCACGGCAAACTTATCACGCCCTCGAGGC
TGATGCAGATGGGCTACGATGCCGTGTGCCGGCAGAAAAAGGCCCAGGGCGGCAGCAGCACCGCCTGTGTTGCCG
TCGCCGACCCATCGGGCGTGGTAGAAGTGGCCAATCTCGGCGATTCGGGCTTCCTGCACCTGCGCCCCAATGCCA
TCATCTACCGGTCCAAGGGCCAGAGCCACGATTTCAACACCCCTTACCAGCTGCGTTGCCCGAAGCCGAGCAGCA
ACGTGTTGGTCCTCGGCGATAGGCCCGACGACGCCGACGTCGTCTATCACTCTGTTCGTCACGGTGACATCCTCA
TCTTGGCCACGGACGGCCTCCTCGACAATCAGTATGGTCATGACATACTCCGCAAGGTCAACCACGTCATGCTGT
CGAGTGGTGCCTGGCAACCGACACAGTCGAGAGGCCTTGGCGTCAGCGACAATTTGAGGAGCTTGATAGACATGG
GATCCGGCTGCCCGCTTCATACGGAGCTGGCCAGGGTGCTGACGCGGTCAGCCAGGACGGCCAGCCTAAGCAATG
TCGACGGTCCGTTCGCCAAGAAGGTGCAGCAGCACGACCCTGCGGCCCACTACTTTGGGGGCAAGCAGGACGACA
TTACCGTCGTCGTCGGCATTGTTTGCGACGAGGCTGTCGCCGGATAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail