Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|64
Gene name
Locationscaffold_1:158079..161899
Strand-
Gene length (bp)3820
Transcript length (bp)3699
Coding sequence length (bp)3696
Protein length (aa) 1232

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00168 C2 C2 domain 3.6E-14 583 689
PF00168 C2 C2 domain 1.3E-05 826 913

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9USG8|MU190_SCHPO Meiotically up-regulated gene 190 protein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mug190 PE=1 SV=1 137 1138 8.0E-141
sp|B6ETT4|SYT2_ARATH Synaptotagmin-2 OS=Arabidopsis thaliana GN=SYT2 PE=2 SV=1 471 686 8.0E-09
sp|Q9SKR2|SYT1_ARATH Synaptotagmin-1 OS=Arabidopsis thaliana GN=SYT1 PE=1 SV=2 471 718 4.0E-08
sp|Q3U7R1|ESYT1_MOUSE Extended synaptotagmin-1 OS=Mus musculus GN=Esyt1 PE=1 SV=2 491 645 2.0E-07
sp|Q9BSJ8|ESYT1_HUMAN Extended synaptotagmin-1 OS=Homo sapiens GN=ESYT1 PE=1 SV=1 491 645 3.0E-07
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9USG8|MU190_SCHPO Meiotically up-regulated gene 190 protein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mug190 PE=1 SV=1 137 1138 8.0E-141
sp|B6ETT4|SYT2_ARATH Synaptotagmin-2 OS=Arabidopsis thaliana GN=SYT2 PE=2 SV=1 471 686 8.0E-09
sp|Q9SKR2|SYT1_ARATH Synaptotagmin-1 OS=Arabidopsis thaliana GN=SYT1 PE=1 SV=2 471 718 4.0E-08
sp|Q3U7R1|ESYT1_MOUSE Extended synaptotagmin-1 OS=Mus musculus GN=Esyt1 PE=1 SV=2 491 645 2.0E-07
sp|Q9BSJ8|ESYT1_HUMAN Extended synaptotagmin-1 OS=Homo sapiens GN=ESYT1 PE=1 SV=1 491 645 3.0E-07
sp|Q9LVH4|CAR4_ARATH Protein C2-DOMAIN ABA-RELATED 4 OS=Arabidopsis thaliana GN=CAR4 PE=1 SV=1 581 680 5.0E-07
sp|A0FGR8|ESYT2_HUMAN Extended synaptotagmin-2 OS=Homo sapiens GN=ESYT2 PE=1 SV=1 489 708 7.0E-07
sp|Q8LFN9|AGD13_ARATH Probable ADP-ribosylation factor GTPase-activating protein AGD13 OS=Arabidopsis thaliana GN=AGD13 PE=2 SV=1 581 707 1.0E-06
sp|Q5RAG2|ESYT1_PONAB Extended synaptotagmin-1 OS=Pongo abelii GN=ESYT1 PE=2 SV=2 491 645 1.0E-06
sp|Q93XX4|C2D61_ARATH C2 domain-containing protein At1g53590 OS=Arabidopsis thaliana GN=NTMC2T6.1 PE=1 SV=2 465 693 2.0E-06
sp|Q9S7J9|CAR9_ARATH Protein C2-DOMAIN ABA-RELATED 9 OS=Arabidopsis thaliana GN=CAR9 PE=2 SV=1 581 683 5.0E-06
sp|Q8CFI0|NED4L_MOUSE E3 ubiquitin-protein ligase NEDD4-like OS=Mus musculus GN=Nedd4l PE=1 SV=2 599 723 8.0E-06
sp|Q96PU5|NED4L_HUMAN E3 ubiquitin-protein ligase NEDD4-like OS=Homo sapiens GN=NEDD4L PE=1 SV=2 599 723 1.0E-05
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 54 0.45

Transmembrane Domains

Domain # Start End Length
1 239 256 17
2 277 299 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
SC16a Pure fungal culture 41.33 22.14 60.51
CcL In ants, during behavior modification 12.88 6.75 19.01
CcD In ants, recently dead 9.08 4.43 13.73

Differential expression

Label1 Label2 Q-value Significant difference
SC16a CcL 0.000286 yes
SC16a CcD 0.000286 yes
CcL CcD 0.159128 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|64
MDDLDDVRRYQAPYGARRPVPTISRYLEEKAARQQEALQENEEDAEDEEDEAVAATDDGAAATSSSSSPWALLAA
GKPEWRHSISSLAASRVRSDEDGGGSNDKAGRDDEKAGPDLGEDVPKDTSQYSPGTAHPKRRRRQLRSRKRERAE
REVTDPITHLPVMIHDFTSESLAQLDYNDPPSGTTPETATGTAGKHKSMEELGREQESMQRDHDLLVDRFPPPEL
EALGRNMVAMFERSLMMGLAGTAAIVFVALSTRQTAAEDESSTRLSRVVAAVTATLGAVAAVVGLIMAVRWYAVR
KMDGLFRDELWDAQRRQAAVRVGRHQAESTVWLNSLLSSVWPLVNPDLFASLSDTLEDVMQASLPRFVRMVSIED
LGQGSEALRILGVRWLPTGAAARTVRADGTLAPEEDGTSGRSSSSDGRSSRGQPPLSAMTGEEGDFVNLEVAFAY
RTRSSSKSLKERTKDMHLYIAFYLPGNIKVPVWVDLQGIVGSMRLRLQLTPDPPFFALCTVSFMGQPKVDLSCVP
LSRHGLNIMDVPLISKFVQSAVDAAVAEYVAPKSLTIDLRDMLAGDDFKKDTTSTGVLMINIRRGYHFKMGDVGI
PLLKEGSSDPYVSVAWAKFGKVLWSTRVIDSEMEPVWDETCFVVVTPEELNIDERVRVQLWDSDRFTADDDLGRI
EVPLKELMTDERSRGRMWNRVDGFRALEAGDNMPGKLEWSVGYFSKTGVEPCQFSRQTYDPDIRSMAELRESVDT
ECERKLRETMLKEGRTDRDEAELEQLKAQEFKQKQDAMVMSAPPPDGYPSGLLGLQIHNITGLEVDKPNKKQAED
DDEASDEEETGESLPSSYCTIIINHSKTYKTRTKPQNAKPFFNAGCERFVRDWRECEVFVSVRDARLHEDNPLLG
IVHLPLGEVFKERSQVMGFWPLTGGIGHGRIRLSLIWRSVGLQAPRNLLGWSYGTVEVQAQATSADCPEELRSCK
LKLTTNISMGKMYPLPGSGTGSETEWKAKKEQHLSLAVTRRYSSCMAVSFKNKGFFGDKVAAFCVLWLKDVPDEE
EQTLELPIWKGDRERAMACCLDECGERMGSLRMKLTFLEGMGNAHSKWASRKQNLRDVVEVMETARDSLETDEMR
REASTASEEASSDSDSSDGSDVAKSVKSTGGGTVPDGSVGHRQGPLDQIRDYRRRDKALHRQHRGVMQWKIPRTA
RWVKHKIGKVGGGVSGLFDHHARQSGGIETEV
Coding >Ophio5|64
ATGGACGACCTGGACGACGTGCGAAGATACCAGGCGCCGTACGGTGCGAGACGTCCTGTACCGACCATATCCAGA
TACCTCGAGGAGAAGGCTGCGCGGCAGCAGGAAGCCCTGCAGGAAAACGAGGAGGACGCGGAGGACGAGGAGGAC
GAGGCTGTGGCTGCTACCGATGATGGGGCTGCGGCTACGTCGTCGTCGTCGTCACCATGGGCCTTGTTAGCTGCT
GGGAAGCCCGAATGGCGGCATTCGATATCCTCCCTCGCCGCCAGTCGGGTCCGAAGCGACGAGGACGGCGGCGGA
AGCAACGACAAGGCCGGCCGAGACGATGAAAAAGCCGGGCCGGACCTCGGCGAGGACGTCCCCAAGGACACGTCT
CAGTACAGCCCGGGGACGGCGCATCCGAAGCGAAGACGTAGACAGCTCCGAAGCCGGAAGCGGGAGCGGGCAGAG
CGGGAGGTGACGGATCCCATCACTCACCTACCCGTTATGATCCACGACTTCACGTCCGAGTCGCTGGCCCAGCTC
GACTACAACGACCCGCCGAGCGGAACGACGCCCGAGACGGCCACGGGCACGGCCGGCAAGCACAAGTCGATGGAG
GAGCTGGGGCGGGAACAGGAGTCGATGCAACGCGATCACGACCTCCTCGTCGACCGCTTTCCGCCGCCGGAGCTG
GAGGCTCTGGGACGCAACATGGTGGCCATGTTCGAGCGCAGCCTGATGATGGGTCTGGCTGGCACGGCCGCTATC
GTCTTCGTCGCGCTATCGACGCGGCAGACGGCGGCCGAGGACGAGTCATCGACAAGGCTGTCACGCGTCGTGGCG
GCCGTCACGGCCACGCTCGGGGCCGTTGCCGCCGTCGTCGGACTCATCATGGCCGTGAGATGGTACGCCGTCCGC
AAGATGGACGGCCTCTTCCGTGACGAGCTTTGGGATGCGCAGCGGCGACAGGCTGCGGTACGAGTTGGCCGGCAC
CAGGCCGAGTCGACGGTCTGGCTCAACTCGCTCCTCAGTTCCGTCTGGCCCCTCGTCAATCCTGACTTATTCGCC
AGTCTGTCGGATACGCTCGAGGACGTGATGCAGGCGTCGCTGCCACGTTTCGTCCGAATGGTCAGCATCGAGGAC
CTCGGTCAGGGCAGCGAGGCCTTGCGCATCCTCGGCGTGCGCTGGCTGCCGACGGGCGCCGCGGCTCGAACGGTG
CGTGCCGATGGGACTCTGGCCCCTGAAGAGGACGGAACGAGCGGCCGCTCATCCTCCTCCGATGGCCGCAGCTCC
CGCGGACAGCCCCCCCTGAGCGCCATGACGGGAGAGGAGGGCGACTTTGTCAATCTTGAGGTCGCCTTTGCCTAC
CGTACGCGGTCCAGCTCCAAGAGCCTCAAGGAACGCACCAAGGACATGCATCTCTACATTGCCTTTTACCTGCCC
GGCAACATCAAGGTCCCCGTCTGGGTGGACCTGCAGGGCATCGTCGGCTCCATGAGACTGCGGCTGCAGCTGACG
CCCGATCCGCCCTTCTTTGCGCTCTGCACAGTGTCCTTTATGGGACAGCCCAAGGTCGACCTCAGCTGCGTGCCG
CTGAGCCGGCACGGGCTCAACATTATGGACGTGCCGCTCATCAGCAAGTTCGTGCAGTCGGCCGTCGACGCCGCC
GTGGCCGAGTACGTGGCGCCCAAGAGCCTCACCATCGACCTCAGGGACATGCTGGCGGGCGACGATTTCAAAAAG
GACACGACTTCGACGGGCGTTCTCATGATCAACATCCGGCGCGGCTACCACTTCAAGATGGGCGACGTCGGCATC
CCGCTGTTGAAGGAGGGCAGCTCGGATCCGTACGTGTCCGTGGCGTGGGCCAAGTTCGGCAAGGTCCTCTGGAGC
ACGCGCGTCATCGATTCCGAGATGGAGCCCGTATGGGACGAGACGTGCTTCGTCGTCGTCACGCCCGAGGAGCTC
AACATCGACGAGAGGGTGCGCGTCCAGCTGTGGGACTCGGATCGTTTCACCGCCGACGACGACCTGGGCCGCATC
GAGGTGCCGCTCAAGGAGCTCATGACGGACGAGCGGTCTAGGGGTCGTATGTGGAATCGCGTCGACGGCTTTCGC
GCTCTCGAGGCTGGCGACAACATGCCCGGCAAGCTGGAGTGGAGCGTGGGATATTTTTCCAAGACGGGCGTCGAG
CCGTGCCAATTCTCGCGGCAGACGTACGACCCTGACATTCGATCAATGGCGGAGCTGAGGGAGTCGGTCGATACC
GAGTGCGAGAGGAAGCTGCGTGAGACGATGCTCAAGGAGGGTCGGACGGACCGGGACGAGGCCGAGCTGGAACAA
CTCAAGGCGCAAGAGTTCAAGCAGAAGCAGGACGCCATGGTCATGTCGGCGCCGCCGCCGGACGGTTACCCCAGC
GGCCTGCTCGGCTTGCAGATCCATAACATCACCGGCCTGGAGGTGGACAAGCCGAACAAGAAGCAGGCCGAGGAC
GATGACGAGGCGAGCGACGAGGAGGAGACGGGCGAGAGCCTACCGAGCTCGTACTGCACCATCATCATCAACCAC
AGCAAGACGTACAAGACGAGGACTAAGCCGCAGAACGCTAAGCCCTTCTTCAACGCCGGCTGCGAGCGCTTCGTG
CGCGACTGGCGGGAGTGCGAGGTCTTTGTCTCGGTCCGGGACGCGAGATTGCACGAGGACAACCCGTTACTGGGC
ATCGTGCACCTACCGCTGGGCGAAGTCTTCAAGGAGCGGTCGCAGGTCATGGGATTCTGGCCTCTGACGGGCGGC
ATCGGCCACGGCCGCATCCGGCTGTCGCTGATCTGGCGGAGCGTCGGGCTGCAGGCTCCGCGTAACCTCCTGGGC
TGGAGCTACGGCACGGTTGAGGTGCAGGCCCAGGCCACGAGCGCCGACTGTCCCGAGGAGCTCCGGTCGTGCAAG
CTCAAGCTGACGACCAACATCAGCATGGGCAAGATGTATCCGTTACCGGGAAGCGGGACCGGATCCGAGACCGAG
TGGAAGGCCAAGAAGGAGCAACATTTGAGCCTGGCGGTGACGAGACGCTATAGCAGCTGTATGGCCGTTTCGTTC
AAGAATAAAGGCTTCTTCGGCGACAAGGTGGCTGCCTTTTGCGTTCTGTGGCTCAAGGACGTACCGGACGAGGAG
GAGCAGACGCTCGAGCTGCCCATCTGGAAGGGGGACCGCGAGCGGGCCATGGCCTGCTGTCTGGACGAGTGCGGC
GAGCGGATGGGCAGTCTGCGTATGAAGCTGACGTTCCTGGAAGGCATGGGCAACGCGCACTCCAAGTGGGCATCA
AGGAAGCAGAACCTCCGAGACGTGGTGGAGGTGATGGAGACGGCGCGGGACAGCCTCGAAACAGACGAGATGCGG
CGGGAGGCGAGCACGGCGAGCGAAGAGGCTTCAAGCGATAGCGACAGCTCCGACGGCTCCGACGTCGCCAAGAGC
GTGAAGAGCACCGGCGGAGGGACCGTCCCGGACGGCAGTGTCGGACACAGACAGGGGCCGCTGGATCAGATCCGA
GACTATCGTCGGCGAGACAAGGCGCTGCATCGGCAGCATCGGGGGGTAATGCAGTGGAAGATTCCGCGGACGGCG
AGATGGGTCAAGCACAAGATTGGCAAGGTCGGTGGCGGCGTCAGCGGGCTGTTTGACCACCATGCCCGTCAGTCG
GGGGGCATCGAGACGGAGGTG
Transcript >Ophio5|64
ATGGACGACCTGGACGACGTGCGAAGATACCAGGCGCCGTACGGTGCGAGACGTCCTGTACCGACCATATCCAGA
TACCTCGAGGAGAAGGCTGCGCGGCAGCAGGAAGCCCTGCAGGAAAACGAGGAGGACGCGGAGGACGAGGAGGAC
GAGGCTGTGGCTGCTACCGATGATGGGGCTGCGGCTACGTCGTCGTCGTCGTCACCATGGGCCTTGTTAGCTGCT
GGGAAGCCCGAATGGCGGCATTCGATATCCTCCCTCGCCGCCAGTCGGGTCCGAAGCGACGAGGACGGCGGCGGA
AGCAACGACAAGGCCGGCCGAGACGATGAAAAAGCCGGGCCGGACCTCGGCGAGGACGTCCCCAAGGACACGTCT
CAGTACAGCCCGGGGACGGCGCATCCGAAGCGAAGACGTAGACAGCTCCGAAGCCGGAAGCGGGAGCGGGCAGAG
CGGGAGGTGACGGATCCCATCACTCACCTACCCGTTATGATCCACGACTTCACGTCCGAGTCGCTGGCCCAGCTC
GACTACAACGACCCGCCGAGCGGAACGACGCCCGAGACGGCCACGGGCACGGCCGGCAAGCACAAGTCGATGGAG
GAGCTGGGGCGGGAACAGGAGTCGATGCAACGCGATCACGACCTCCTCGTCGACCGCTTTCCGCCGCCGGAGCTG
GAGGCTCTGGGACGCAACATGGTGGCCATGTTCGAGCGCAGCCTGATGATGGGTCTGGCTGGCACGGCCGCTATC
GTCTTCGTCGCGCTATCGACGCGGCAGACGGCGGCCGAGGACGAGTCATCGACAAGGCTGTCACGCGTCGTGGCG
GCCGTCACGGCCACGCTCGGGGCCGTTGCCGCCGTCGTCGGACTCATCATGGCCGTGAGATGGTACGCCGTCCGC
AAGATGGACGGCCTCTTCCGTGACGAGCTTTGGGATGCGCAGCGGCGACAGGCTGCGGTACGAGTTGGCCGGCAC
CAGGCCGAGTCGACGGTCTGGCTCAACTCGCTCCTCAGTTCCGTCTGGCCCCTCGTCAATCCTGACTTATTCGCC
AGTCTGTCGGATACGCTCGAGGACGTGATGCAGGCGTCGCTGCCACGTTTCGTCCGAATGGTCAGCATCGAGGAC
CTCGGTCAGGGCAGCGAGGCCTTGCGCATCCTCGGCGTGCGCTGGCTGCCGACGGGCGCCGCGGCTCGAACGGTG
CGTGCCGATGGGACTCTGGCCCCTGAAGAGGACGGAACGAGCGGCCGCTCATCCTCCTCCGATGGCCGCAGCTCC
CGCGGACAGCCCCCCCTGAGCGCCATGACGGGAGAGGAGGGCGACTTTGTCAATCTTGAGGTCGCCTTTGCCTAC
CGTACGCGGTCCAGCTCCAAGAGCCTCAAGGAACGCACCAAGGACATGCATCTCTACATTGCCTTTTACCTGCCC
GGCAACATCAAGGTCCCCGTCTGGGTGGACCTGCAGGGCATCGTCGGCTCCATGAGACTGCGGCTGCAGCTGACG
CCCGATCCGCCCTTCTTTGCGCTCTGCACAGTGTCCTTTATGGGACAGCCCAAGGTCGACCTCAGCTGCGTGCCG
CTGAGCCGGCACGGGCTCAACATTATGGACGTGCCGCTCATCAGCAAGTTCGTGCAGTCGGCCGTCGACGCCGCC
GTGGCCGAGTACGTGGCGCCCAAGAGCCTCACCATCGACCTCAGGGACATGCTGGCGGGCGACGATTTCAAAAAG
GACACGACTTCGACGGGCGTTCTCATGATCAACATCCGGCGCGGCTACCACTTCAAGATGGGCGACGTCGGCATC
CCGCTGTTGAAGGAGGGCAGCTCGGATCCGTACGTGTCCGTGGCGTGGGCCAAGTTCGGCAAGGTCCTCTGGAGC
ACGCGCGTCATCGATTCCGAGATGGAGCCCGTATGGGACGAGACGTGCTTCGTCGTCGTCACGCCCGAGGAGCTC
AACATCGACGAGAGGGTGCGCGTCCAGCTGTGGGACTCGGATCGTTTCACCGCCGACGACGACCTGGGCCGCATC
GAGGTGCCGCTCAAGGAGCTCATGACGGACGAGCGGTCTAGGGGTCGTATGTGGAATCGCGTCGACGGCTTTCGC
GCTCTCGAGGCTGGCGACAACATGCCCGGCAAGCTGGAGTGGAGCGTGGGATATTTTTCCAAGACGGGCGTCGAG
CCGTGCCAATTCTCGCGGCAGACGTACGACCCTGACATTCGATCAATGGCGGAGCTGAGGGAGTCGGTCGATACC
GAGTGCGAGAGGAAGCTGCGTGAGACGATGCTCAAGGAGGGTCGGACGGACCGGGACGAGGCCGAGCTGGAACAA
CTCAAGGCGCAAGAGTTCAAGCAGAAGCAGGACGCCATGGTCATGTCGGCGCCGCCGCCGGACGGTTACCCCAGC
GGCCTGCTCGGCTTGCAGATCCATAACATCACCGGCCTGGAGGTGGACAAGCCGAACAAGAAGCAGGCCGAGGAC
GATGACGAGGCGAGCGACGAGGAGGAGACGGGCGAGAGCCTACCGAGCTCGTACTGCACCATCATCATCAACCAC
AGCAAGACGTACAAGACGAGGACTAAGCCGCAGAACGCTAAGCCCTTCTTCAACGCCGGCTGCGAGCGCTTCGTG
CGCGACTGGCGGGAGTGCGAGGTCTTTGTCTCGGTCCGGGACGCGAGATTGCACGAGGACAACCCGTTACTGGGC
ATCGTGCACCTACCGCTGGGCGAAGTCTTCAAGGAGCGGTCGCAGGTCATGGGATTCTGGCCTCTGACGGGCGGC
ATCGGCCACGGCCGCATCCGGCTGTCGCTGATCTGGCGGAGCGTCGGGCTGCAGGCTCCGCGTAACCTCCTGGGC
TGGAGCTACGGCACGGTTGAGGTGCAGGCCCAGGCCACGAGCGCCGACTGTCCCGAGGAGCTCCGGTCGTGCAAG
CTCAAGCTGACGACCAACATCAGCATGGGCAAGATGTATCCGTTACCGGGAAGCGGGACCGGATCCGAGACCGAG
TGGAAGGCCAAGAAGGAGCAACATTTGAGCCTGGCGGTGACGAGACGCTATAGCAGCTGTATGGCCGTTTCGTTC
AAGAATAAAGGCTTCTTCGGCGACAAGGTGGCTGCCTTTTGCGTTCTGTGGCTCAAGGACGTACCGGACGAGGAG
GAGCAGACGCTCGAGCTGCCCATCTGGAAGGGGGACCGCGAGCGGGCCATGGCCTGCTGTCTGGACGAGTGCGGC
GAGCGGATGGGCAGTCTGCGTATGAAGCTGACGTTCCTGGAAGGCATGGGCAACGCGCACTCCAAGTGGGCATCA
AGGAAGCAGAACCTCCGAGACGTGGTGGAGGTGATGGAGACGGCGCGGGACAGCCTCGAAACAGACGAGATGCGG
CGGGAGGCGAGCACGGCGAGCGAAGAGGCTTCAAGCGATAGCGACAGCTCCGACGGCTCCGACGTCGCCAAGAGC
GTGAAGAGCACCGGCGGAGGGACCGTCCCGGACGGCAGTGTCGGACACAGACAGGGGCCGCTGGATCAGATCCGA
GACTATCGTCGGCGAGACAAGGCGCTGCATCGGCAGCATCGGGGGGTAATGCAGTGGAAGATTCCGCGGACGGCG
AGATGGGTCAAGCACAAGATTGGCAAGGTCGGTGGCGGCGTCAGCGGGCTGTTTGACCACCATGCCCGTCAGTCG
GGGGGCATCGAGACGGAGGTGTAG
Gene >Ophio5|64
ATGGACGACCTGGACGACGTGCGAAGATACCAGGCGCCGTACGGTGCGAGACGTCCTGTACCGACCATATCCAGA
TACCTCGAGGAGAAGGCTGCGCGGCAGCAGGAAGCCCTGCAGGAAAACGAGGAGGACGCGGAGGACGAGGAGGAC
GAGGCTGTGGCTGCTACCGATGATGGGGCTGCGGCTACGTCGTCGTCGTCGTCACCATGGGCCTTGTTAGCTGCT
GGGAAGCCCGAATGGCGGCATTCGATATCCTCCCTCGCCGCCAGTCGGGTCCGAAGCGACGAGGACGGCGGCGGA
AGCAACGACAAGGCCGGCCGAGACGATGAAAAAGCCGGGCCGGACCTCGGCGAGGACGTCCCCAAGGACACGTCT
CAGTACAGCCCGGGGACGGCGCATCCGAAGCGAAGACGTAGACAGCTCCGAAGCCGGAAGCGGGAGCGGGCAGAG
CGGGAGGTGACGGATCCCATCACTCACCTACCCGTTATGATCCACGACTTCACGTCCGAGTCGCTGGCCCAGCTC
GACTACAACGACCCGCCGAGCGGAACGACGCCCGAGACGGCCACGGGCACGGCCGGCAAGCACAAGTCGATGGAG
GAGCTGGGGCGGGAACAGGAGTCGATGCAACGCGATCACGACCTCCTCGTCGACCGCTTTCCGCCGCCGGAGCTG
GAGGCTCTGGGACGCAACATGGTGGCCATGTTCGAGCGCAGCCTGATGATGGGTCTGGCTGGCACGGCCGCTATC
GTCTTCGTCGCGCTATCGACGCGGCAGACGGCGGCCGAGGACGAGTCATCGACAAGGCTGTCACGCGTCGTGGCG
GCCGTCACGGCCACGCTCGGGGCCGTTGCCGCCGTCGTCGGACTCATCATGGCCGTGAGATGGTACGCCGTCCGC
AAGATGGACGGCCTCTTCCGTGACGAGCTTTGGGATGCGCAGCGGCGACAGGCTGCGGTACGAGTTGGCCGGCAC
CAGGCCGAGTCGACGGTCTGGCTCAACTCGCTCCTCAGTTCCGTCTGGCCCCTCGTCAATCCTGACTTATTCGCC
AGTCTGTCGGATACGCTCGAGGACGTGATGCAGGCGTCGCTGCCACGTTTCGTCCGAATGGTCAGCATCGAGGAC
CTCGGTCAGGGCAGCGAGGCCTTGCGCATCCTCGGCGTGCGCTGGCTGCCGACGGGCGCCGCGGCTCGAACGGTG
CGTGCCGATGGGACTCTGGCCCCTGAAGAGGACGGAACGAGCGGCCGCTCATCCTCCTCCGATGGCCGCAGCTCC
CGCGGACAGCCCCCCCTGAGCGCCATGACGGGAGAGGAGGGCGACTTTGTCAATCTTGAGGTCGCCTTTGCCTAC
CGTACGCGGTCCAGCTCCAAGAGCCTCAAGGAACGCACCAAGGACATGCATCTCTACATTGCCTTTTACCTGCCC
GGCAACATCAAGGTCCCCGTCTGGGTGGACCTGCAGGGCATCGTCGGCTCCATGAGACTGCGGCTGCAGCTGACG
CCCGATCCGCCCTTCTTTGCGCTCTGCACAGTGTCCTTTATGGGACAGCCCAAGGTCGACCTCAGCTGCGTGCCG
CTGAGCCGGCACGGGCTCAACATTATGGACGTGCCGCTCATCAGCAAGTTCGTGCAGTCGGCCGTCGACGCCGCC
GTGGCCGAGTACGTGGCGCCCAAGAGCCTCACCATCGACCTCAGGGACATGCTGGCGGGCGACGATTTCAAAAAG
GACACGACTTCGACGGGCGTTCTCATGATCAACATCCGGCGCGGCTACCACTTCAAGATGGGCGACGTCGGCATC
CCGCTGTTGAAGGAGGGCAGCTCGGATCCGTACGTGTCCGTGGCGTGGGCCAAGTTCGGCAAGGTCCTCTGGAGC
ACGCGCGTCATCGATTCCGAGATGGAGCCCGTATGGGACGAGACGTGCTTCGTCGTCGTCACGCCCGAGGAGCTC
AACATCGACGAGAGGGTGCGCGTCCAGCTGTGGGACTCGGATCGTTTCACCGCCGACGACGACCTGGGCCGCATC
GAGGTGCCGCTCAAGGAGCTCATGACGGACGAGCGGTCTAGGGGTCGTATGTGGAATCGCGTCGACGGCTTTCGC
GCTCTCGAGGCTGGCGACAACATGCCCGGCAAGCTGGAGTGGAGCGTGGGATATTTTTCCAAGACGGGCGTCGAG
CCGTGCCAATTCTCGCGGCAGACGTACGACCCTGACATTCGATCAATGGCGGAGCTGAGGGAGTCGGTCGATACC
GAGTGCGAGAGGAAGCTGCGTGAGACGATGCTCAAGGAGGGTCGGACGGACCGGGACGAGGCCGAGCTGGAACAA
CTCAAGGCGCAAGAGTTCAAGCAGAAGCAGGACGCCATGGTCATGTCGGCGCCGCCGCCGGACGGTTACCCCAGC
GGCCTGCTCGGCTTGCAGATCCATAACATCACCGGCCTGGAGGTGGACAAGCCGAACAAGAAGCAGGCCGAGGAC
GATGACGAGGCGAGCGACGAGGAGGAGACGGGCGAGAGCCTACCGAGCTCGTACTGCACCATCATCATCAACCAC
AGCAAGACGTACAAGACGAGGACTAAGCCGCAGAACGCTAAGCCCTTCTTCAACGCCGGCTGCGAGCGCTTCGTG
CGCGACTGGCGGGAGTGCGAGGTCTTTGTCTCGGTCCGGGACGCGAGATTGCACGAGGACAACCCGTTACTGGGC
ATCGTGCACCTACCGCTGGGCGAAGTCTTCAAGGAGCGGTCGCAGGTCATGGGATTCTGGCCTCTGACGGGCGGC
ATCGGCCACGGCCGCATCCGGCTGTCGCTGATCTGGCGGAGCGTCGGGCTGCAGGCTCCGCGTAACCTCCTGGGC
TGGAGCTACGGCACGGTTGAGGTGCAGGCCCAGGCCACGAGCGCCGACTGTCCCGAGGAGCTCCGGTCGTGCAAG
CTCAAGCTGACGACCAACATCAGCATGGGCAAGATGTATCCGTTACCGGGAAGCGGGACCGGATCCGAGACCGAG
TGGAAGGCCAAGAAGGAGCAACATTTGAGCCTGGCGGTGACGAGACGCTATAGCAGCTGTATGGCCGTTTCGTTC
AAGAATAAAGGCTTCTTCGGCGACAAGGTGGCTGCCTTTTGCGTTCTGTGGCTCAAGGACGTACCGGACGAGGAG
GAGCAGACGCTCGAGCTGCCCATCTGGAAGGGGGACCGCGAGCGGGCCATGGCCTGCTGTCTGGACGAGTGCGGC
GAGCGGATGGGCAGTCTGCGTATGAAGCTGACGTTCCTGGAAGGCATGGTGAGTAGCCTCGAGCTCTTGGTTAGC
TGTTGCCGAGTACGAGCTAACACGCAGCGTGTTCAAGGGCAACGCGCACTCCAAGTGGGCATCAAGGAAGCAGAA
CCTCCGAGACGTGGTGGAGGTGATGGAGACGGCGCGGGACAGCCTCGAAACAGACGAGATGCGGCGGGAGGCGAG
CACGGCGAGCGAAGAGGCTTCAAGCGATAGCGACAGCTCCGACGGCTCCGACGTCGCCAAGAGCGTGAAGAGCAC
CGGCGGAGGGACCGTCCCGGACGGCAGTGTCGGACACAGACAGGGGCCGCTGGATCAGATCCGAGACTATCGTCG
GCGAGACAAGGCGCTGCATCGGCAGCATCGGGGGGTAATGCAGTGGAAGGTGGGTTTCATCCTCGAGCGAGCTCT
TCTTACGCGGCGACGGCTGACGGGTGACAAGATTCCGCGGACGGCGAGATGGGTCAAGCACAAGATTGGCAAGGT
CGGTGGCGGCGTCAGCGGGCTGTTTGACCACCATGCCCGTCAGTCGGGGGGCATCGAGACGGAGGTGTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail