Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|639
Gene name
Locationscaffold_117:28714..33094
Strand+
Gene length (bp)4380
Transcript length (bp)3432
Coding sequence length (bp)3429
Protein length (aa) 1143

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01636 APH Phosphotransferase enzyme family 3.7E-41 66 302

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q8K370|ACD10_MOUSE Acyl-CoA dehydrogenase family member 10 OS=Mus musculus GN=Acad10 PE=1 SV=1 45 388 2.0E-66
sp|Q6JQN1|ACD10_HUMAN Acyl-CoA dehydrogenase family member 10 OS=Homo sapiens GN=ACAD10 PE=1 SV=1 45 388 9.0E-66
sp|Q8RWZ3|IBR3_ARATH Probable acyl-CoA dehydrogenase IBR3 OS=Arabidopsis thaliana GN=IBR3 PE=1 SV=1 46 387 3.0E-62
sp|B3DMA2|ACD11_RAT Acyl-CoA dehydrogenase family member 11 OS=Rattus norvegicus GN=Acad11 PE=1 SV=1 42 414 5.0E-62
sp|Q5ZHT1|ACD11_CHICK Acyl-CoA dehydrogenase family member 11 OS=Gallus gallus GN=ACAD11 PE=2 SV=1 40 390 3.0E-60
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q8K370|ACD10_MOUSE Acyl-CoA dehydrogenase family member 10 OS=Mus musculus GN=Acad10 PE=1 SV=1 45 388 2.0E-66
sp|Q6JQN1|ACD10_HUMAN Acyl-CoA dehydrogenase family member 10 OS=Homo sapiens GN=ACAD10 PE=1 SV=1 45 388 9.0E-66
sp|Q8RWZ3|IBR3_ARATH Probable acyl-CoA dehydrogenase IBR3 OS=Arabidopsis thaliana GN=IBR3 PE=1 SV=1 46 387 3.0E-62
sp|B3DMA2|ACD11_RAT Acyl-CoA dehydrogenase family member 11 OS=Rattus norvegicus GN=Acad11 PE=1 SV=1 42 414 5.0E-62
sp|Q5ZHT1|ACD11_CHICK Acyl-CoA dehydrogenase family member 11 OS=Gallus gallus GN=ACAD11 PE=2 SV=1 40 390 3.0E-60
sp|Q80XL6|ACD11_MOUSE Acyl-CoA dehydrogenase family member 11 OS=Mus musculus GN=Acad11 PE=1 SV=2 42 414 1.0E-59
sp|Q5R778|ACD11_PONAB Acyl-CoA dehydrogenase family member 11 OS=Pongo abelii GN=ACAD11 PE=2 SV=2 28 390 5.0E-59
sp|Q709F0|ACD11_HUMAN Acyl-CoA dehydrogenase family member 11 OS=Homo sapiens GN=ACAD11 PE=1 SV=2 28 390 2.0E-56
sp|Q12324|YVC1_YEAST Calcium channel YVC1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YVC1 PE=1 SV=2 612 982 4.0E-15
sp|Q5A2J7|YVC1_CANAL Calcium channel YVC1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=YVC1 PE=2 SV=1 612 1048 2.0E-12
sp|P9WI99|Y3168_MYCTU Putative aminoglycoside phosphotransferase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=Rv3168 PE=1 SV=1 48 289 1.0E-06
sp|P9WI98|Y3168_MYCTO Putative aminoglycoside phosphotransferase OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=MT3257 PE=3 SV=1 48 289 1.0E-06
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 29 0.45

Transmembrane Domains

Domain # Start End Length
1 687 706 19
2 719 738 19
3 748 770 22
4 783 802 19
5 817 839 22
6 872 894 22
7 930 952 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|639
MWRYQPRQCNFGHLGWMMDLGCNSVSLASAGQADVAMAGRVRQPIDEAALERYLDNKVPQIKRPVEVKQFGFGQS
NPTYLVTGADGQRLVLRKKPPGKLLSQTAHKVEREYRIMRGLDATAVPVPKAYCLCEEASVIGTPFYLMEFLDGR
IFEDFAMPGVSADERTKLWRAATETLARLHAVDFNSIGLADFGKHAGFYGRQVQTWSTICAKQEMVADVETGEPV
GRLPHQDDMVRFFSDERLRPRDRATLVHGDFKIDNLVFHKTEARVIGILDWEMSTIGHPLSDVCNFLTHFYTAAQ
PQMGRFSAKGFLPGQTPGLPTAEQMVRWYGEASGYDPSRDLTWGMAFNIFRAAAVAQGIAARQATRQASSEQARE
YAAARGALAELAWKLVQEAASNPGRMKASSSDGPANSRRRRPDALSLIFLCHHEKRVKTESLTLDLFPFFNPRGL
LFASVAKFRSCRPSWRIAGGTSPCRRRFRLNFRRPRLLLILLTLSAESIGHCCLAKATMTRISCATYASTSPSSG
PWSTSSTNSETSPSSSNRQNVNWSRATLCELIATRILRRFGEDYVGTDGLLLLAHVLVAGFHPFQNAPLNIRDEV
SAQSPWKHHRTLPALELAIITESKHFLSSSTCQRVVSAIYDGRIIYTPSTFWDIIPDHYKLKPISLYDPRESPLL
NQYRLIVPRTRTILEAIQFAILLGLYVGVMLRRGKGSITPLETIFAVYAFGWGLDQLATIMAHGWDVYTQNLWSF
LDVTFTCIFSVYLVIRLHGLRLGDPSYAQQAYDVLALAAPVLVPRLAFILLSDNLIFLSLRSMMADFFLLTALSA
WCFFGFLLSLRWLGEGIHPLVTISKWMIYIWFGLDGTGIQRSTEFHWLYGPCIMIAFAFLGNTLFLTILVSMLSN
TFSNISTNAMAEMQFRRAVLTLEGVKADAIFAYQPPFNLLAVFMLLPLKFIVSPRWFHKIHVTMVRLVNLPLLLV
IAVAERRLLWSAGEHESVRPTMRRRLWRKWKVSTHRDIRDVFSVPPPDDVHDDIAVDDDLTHHLIRRQFTRQNTT
TDVQPRKPSRRDSMFPGLASKLRGSFTEESEDQGALAARVESMEKSLQRMEGMLSRLVPDDSASSSSSDGLGEAS
TLKEGEGLTIESSSRGQM
Coding >Ophio5|639
ATGTGGCGCTACCAGCCACGACAATGTAACTTTGGGCACCTTGGATGGATGATGGACCTCGGCTGCAATAGTGTC
AGCCTCGCTTCCGCAGGCCAAGCAGACGTCGCCATGGCGGGAAGGGTACGGCAGCCCATCGACGAGGCGGCCCTG
GAGCGCTATCTCGACAACAAGGTCCCCCAGATCAAGAGGCCCGTGGAGGTGAAGCAGTTCGGCTTCGGCCAATCC
AATCCAACGTACCTGGTGACGGGCGCCGACGGGCAGCGGCTCGTGTTACGAAAAAAGCCACCGGGCAAGCTCCTC
TCCCAAACGGCGCACAAGGTGGAGCGCGAATATCGCATCATGCGTGGGCTCGACGCTACGGCCGTACCGGTTCCC
AAGGCGTACTGCCTGTGCGAGGAGGCGTCGGTCATCGGCACGCCCTTCTACCTCATGGAGTTCCTCGACGGGCGC
ATCTTTGAGGACTTCGCCATGCCCGGCGTCAGCGCCGACGAGCGGACCAAACTATGGCGGGCGGCGACGGAGACG
CTGGCCAGGCTGCACGCCGTCGATTTCAACAGTATCGGGCTGGCCGACTTTGGGAAGCACGCCGGCTTCTACGGT
CGCCAGGTGCAGACGTGGAGCACCATCTGCGCCAAGCAAGAGATGGTGGCCGACGTCGAGACGGGCGAGCCGGTG
GGAAGGCTACCGCACCAGGATGACATGGTGCGATTCTTCAGCGACGAAAGGCTGCGGCCGCGGGACAGGGCGACG
CTGGTGCATGGCGACTTTAAGATTGACAACCTCGTCTTTCACAAGACGGAAGCGCGGGTCATTGGCATACTGGAC
TGGGAAATGTCGACGATCGGGCACCCGCTGTCGGACGTGTGCAACTTCCTGACGCACTTCTACACGGCCGCGCAG
CCGCAGATGGGCCGCTTCTCGGCCAAGGGATTTCTGCCGGGCCAGACGCCCGGGCTGCCGACGGCAGAGCAGATG
GTGAGGTGGTACGGCGAAGCATCGGGCTACGACCCGAGCCGGGATCTGACGTGGGGGATGGCCTTTAACATATTC
CGGGCGGCGGCGGTCGCTCAAGGCATCGCGGCCCGTCAAGCGACGCGGCAAGCCAGCAGCGAGCAGGCCCGGGAA
TATGCGGCGGCGAGGGGAGCGCTGGCCGAGCTGGCCTGGAAGCTGGTGCAGGAGGCGGCGAGCAATCCAGGCCGC
ATGAAAGCCAGCTCATCAGACGGTCCGGCCAATAGCAGGCGACGACGACCCGACGCATTGTCCTTGATTTTCCTT
TGCCACCATGAAAAGAGGGTGAAGACGGAAAGTTTAACGCTAGACTTGTTTCCCTTCTTTAACCCCCGTGGCTTG
TTGTTTGCGTCTGTGGCAAAATTCCGCTCGTGTAGGCCATCATGGCGGATCGCAGGCGGCACATCACCTTGCCGC
CGCCGCTTCCGCCTCAACTTCCGCCGCCCTCGTCTTCTCCTCATTCTTCTCACCCTCTCGGCGGAGAGCATCGGC
CACTGCTGCCTCGCCAAAGCAACAATGACGAGGATCAGTTGCGCGACGTACGCATCAACGTCACCGTCGTCCGGC
CCTTGGTCGACAAGTTCTACGAACTCGGAGACGTCTCCATCGTCGAGTAACCGCCAAAACGTCAACTGGTCGCGC
GCCACCCTGTGTGAGCTCATCGCCACCCGCATCCTCAGGCGTTTCGGCGAGGACTATGTTGGTACCGACGGCTTG
CTGCTTCTGGCCCATGTCCTGGTCGCCGGCTTCCATCCCTTTCAGAATGCGCCGCTCAACATTCGTGACGAGGTC
TCGGCTCAATCGCCTTGGAAGCATCATCGCACCTTGCCCGCTCTCGAGCTGGCCATCATCACCGAGAGCAAGCAC
TTCCTCAGCTCCTCGACCTGCCAGCGCGTCGTCTCCGCCATCTACGACGGTCGCATCATCTACACGCCCTCGACC
TTTTGGGACATCATCCCCGACCACTACAAACTCAAGCCCATATCCCTCTATGACCCCCGCGAGTCGCCCCTGCTC
AATCAGTATCGTCTGATCGTGCCCCGCACACGCACCATCCTCGAGGCCATCCAATTCGCCATTCTGCTGGGCCTG
TACGTGGGCGTCATGCTCCGACGGGGCAAGGGCAGCATCACTCCACTGGAGACCATCTTCGCTGTTTATGCCTTT
GGCTGGGGACTGGATCAACTGGCCACCATCATGGCCCACGGCTGGGACGTCTATACCCAGAACCTGTGGTCCTTT
CTCGACGTCACCTTCACCTGCATCTTCTCCGTCTATCTGGTGATCCGGCTTCACGGGCTGCGACTGGGCGATCCC
AGCTACGCCCAACAGGCCTATGATGTTTTGGCACTGGCAGCCCCCGTCTTGGTACCTCGCCTCGCCTTTATTCTT
CTGTCGGACAATCTGATCTTCCTATCTCTGCGGTCCATGATGGCCGACTTTTTCCTTCTGACGGCGCTGTCTGCC
TGGTGCTTCTTTGGATTCTTGCTCTCGCTGCGGTGGCTGGGAGAGGGCATCCATCCTCTGGTCACGATATCCAAG
TGGATGATTTACATCTGGTTCGGCCTCGATGGCACCGGCATCCAGCGTTCGACGGAGTTCCACTGGCTGTACGGG
CCCTGCATCATGATCGCCTTTGCTTTCCTCGGCAACACTCTCTTCCTCACCATCCTCGTCTCGATGCTCTCAAAT
ACGTTCAGCAACATCTCGACCAACGCCATGGCGGAGATGCAGTTCCGCCGGGCGGTGCTGACGCTCGAGGGCGTC
AAGGCCGACGCCATCTTCGCCTATCAGCCGCCCTTTAACCTCTTGGCCGTCTTCATGCTCCTACCGCTCAAGTTC
ATCGTCAGCCCTCGCTGGTTCCACAAGATCCACGTGACCATGGTGCGGCTGGTGAACCTCCCGCTGCTGCTCGTC
ATCGCCGTCGCTGAGCGCCGTCTGCTCTGGTCGGCGGGCGAGCATGAATCGGTGCGGCCGACGATGAGGCGCCGA
CTCTGGCGCAAGTGGAAGGTGTCGACGCATAGAGATATTCGAGACGTTTTTAGCGTGCCGCCGCCGGACGACGTG
CACGACGATATTGCCGTCGACGACGACCTGACGCATCATCTCATCCGGCGGCAATTCACGCGGCAGAACACGACG
ACGGACGTACAGCCGCGAAAGCCGTCGCGCAGGGACTCGATGTTTCCGGGTCTCGCCAGTAAGCTGCGCGGCTCC
TTTACCGAGGAGAGCGAAGATCAGGGGGCCTTGGCGGCCAGGGTGGAATCGATGGAGAAGTCGCTACAGCGCATG
GAAGGCATGCTTTCGAGGCTGGTCCCGGACGACTCGGCGTCGTCTTCGTCGTCGGACGGGCTGGGAGAGGCCAGC
ACGCTCAAGGAGGGAGAAGGGCTCACGATAGAGTCGAGCTCCAGAGGGCAGATG
Transcript >Ophio5|639
ATGTGGCGCTACCAGCCACGACAATGTAACTTTGGGCACCTTGGATGGATGATGGACCTCGGCTGCAATAGTGTC
AGCCTCGCTTCCGCAGGCCAAGCAGACGTCGCCATGGCGGGAAGGGTACGGCAGCCCATCGACGAGGCGGCCCTG
GAGCGCTATCTCGACAACAAGGTCCCCCAGATCAAGAGGCCCGTGGAGGTGAAGCAGTTCGGCTTCGGCCAATCC
AATCCAACGTACCTGGTGACGGGCGCCGACGGGCAGCGGCTCGTGTTACGAAAAAAGCCACCGGGCAAGCTCCTC
TCCCAAACGGCGCACAAGGTGGAGCGCGAATATCGCATCATGCGTGGGCTCGACGCTACGGCCGTACCGGTTCCC
AAGGCGTACTGCCTGTGCGAGGAGGCGTCGGTCATCGGCACGCCCTTCTACCTCATGGAGTTCCTCGACGGGCGC
ATCTTTGAGGACTTCGCCATGCCCGGCGTCAGCGCCGACGAGCGGACCAAACTATGGCGGGCGGCGACGGAGACG
CTGGCCAGGCTGCACGCCGTCGATTTCAACAGTATCGGGCTGGCCGACTTTGGGAAGCACGCCGGCTTCTACGGT
CGCCAGGTGCAGACGTGGAGCACCATCTGCGCCAAGCAAGAGATGGTGGCCGACGTCGAGACGGGCGAGCCGGTG
GGAAGGCTACCGCACCAGGATGACATGGTGCGATTCTTCAGCGACGAAAGGCTGCGGCCGCGGGACAGGGCGACG
CTGGTGCATGGCGACTTTAAGATTGACAACCTCGTCTTTCACAAGACGGAAGCGCGGGTCATTGGCATACTGGAC
TGGGAAATGTCGACGATCGGGCACCCGCTGTCGGACGTGTGCAACTTCCTGACGCACTTCTACACGGCCGCGCAG
CCGCAGATGGGCCGCTTCTCGGCCAAGGGATTTCTGCCGGGCCAGACGCCCGGGCTGCCGACGGCAGAGCAGATG
GTGAGGTGGTACGGCGAAGCATCGGGCTACGACCCGAGCCGGGATCTGACGTGGGGGATGGCCTTTAACATATTC
CGGGCGGCGGCGGTCGCTCAAGGCATCGCGGCCCGTCAAGCGACGCGGCAAGCCAGCAGCGAGCAGGCCCGGGAA
TATGCGGCGGCGAGGGGAGCGCTGGCCGAGCTGGCCTGGAAGCTGGTGCAGGAGGCGGCGAGCAATCCAGGCCGC
ATGAAAGCCAGCTCATCAGACGGTCCGGCCAATAGCAGGCGACGACGACCCGACGCATTGTCCTTGATTTTCCTT
TGCCACCATGAAAAGAGGGTGAAGACGGAAAGTTTAACGCTAGACTTGTTTCCCTTCTTTAACCCCCGTGGCTTG
TTGTTTGCGTCTGTGGCAAAATTCCGCTCGTGTAGGCCATCATGGCGGATCGCAGGCGGCACATCACCTTGCCGC
CGCCGCTTCCGCCTCAACTTCCGCCGCCCTCGTCTTCTCCTCATTCTTCTCACCCTCTCGGCGGAGAGCATCGGC
CACTGCTGCCTCGCCAAAGCAACAATGACGAGGATCAGTTGCGCGACGTACGCATCAACGTCACCGTCGTCCGGC
CCTTGGTCGACAAGTTCTACGAACTCGGAGACGTCTCCATCGTCGAGTAACCGCCAAAACGTCAACTGGTCGCGC
GCCACCCTGTGTGAGCTCATCGCCACCCGCATCCTCAGGCGTTTCGGCGAGGACTATGTTGGTACCGACGGCTTG
CTGCTTCTGGCCCATGTCCTGGTCGCCGGCTTCCATCCCTTTCAGAATGCGCCGCTCAACATTCGTGACGAGGTC
TCGGCTCAATCGCCTTGGAAGCATCATCGCACCTTGCCCGCTCTCGAGCTGGCCATCATCACCGAGAGCAAGCAC
TTCCTCAGCTCCTCGACCTGCCAGCGCGTCGTCTCCGCCATCTACGACGGTCGCATCATCTACACGCCCTCGACC
TTTTGGGACATCATCCCCGACCACTACAAACTCAAGCCCATATCCCTCTATGACCCCCGCGAGTCGCCCCTGCTC
AATCAGTATCGTCTGATCGTGCCCCGCACACGCACCATCCTCGAGGCCATCCAATTCGCCATTCTGCTGGGCCTG
TACGTGGGCGTCATGCTCCGACGGGGCAAGGGCAGCATCACTCCACTGGAGACCATCTTCGCTGTTTATGCCTTT
GGCTGGGGACTGGATCAACTGGCCACCATCATGGCCCACGGCTGGGACGTCTATACCCAGAACCTGTGGTCCTTT
CTCGACGTCACCTTCACCTGCATCTTCTCCGTCTATCTGGTGATCCGGCTTCACGGGCTGCGACTGGGCGATCCC
AGCTACGCCCAACAGGCCTATGATGTTTTGGCACTGGCAGCCCCCGTCTTGGTACCTCGCCTCGCCTTTATTCTT
CTGTCGGACAATCTGATCTTCCTATCTCTGCGGTCCATGATGGCCGACTTTTTCCTTCTGACGGCGCTGTCTGCC
TGGTGCTTCTTTGGATTCTTGCTCTCGCTGCGGTGGCTGGGAGAGGGCATCCATCCTCTGGTCACGATATCCAAG
TGGATGATTTACATCTGGTTCGGCCTCGATGGCACCGGCATCCAGCGTTCGACGGAGTTCCACTGGCTGTACGGG
CCCTGCATCATGATCGCCTTTGCTTTCCTCGGCAACACTCTCTTCCTCACCATCCTCGTCTCGATGCTCTCAAAT
ACGTTCAGCAACATCTCGACCAACGCCATGGCGGAGATGCAGTTCCGCCGGGCGGTGCTGACGCTCGAGGGCGTC
AAGGCCGACGCCATCTTCGCCTATCAGCCGCCCTTTAACCTCTTGGCCGTCTTCATGCTCCTACCGCTCAAGTTC
ATCGTCAGCCCTCGCTGGTTCCACAAGATCCACGTGACCATGGTGCGGCTGGTGAACCTCCCGCTGCTGCTCGTC
ATCGCCGTCGCTGAGCGCCGTCTGCTCTGGTCGGCGGGCGAGCATGAATCGGTGCGGCCGACGATGAGGCGCCGA
CTCTGGCGCAAGTGGAAGGTGTCGACGCATAGAGATATTCGAGACGTTTTTAGCGTGCCGCCGCCGGACGACGTG
CACGACGATATTGCCGTCGACGACGACCTGACGCATCATCTCATCCGGCGGCAATTCACGCGGCAGAACACGACG
ACGGACGTACAGCCGCGAAAGCCGTCGCGCAGGGACTCGATGTTTCCGGGTCTCGCCAGTAAGCTGCGCGGCTCC
TTTACCGAGGAGAGCGAAGATCAGGGGGCCTTGGCGGCCAGGGTGGAATCGATGGAGAAGTCGCTACAGCGCATG
GAAGGCATGCTTTCGAGGCTGGTCCCGGACGACTCGGCGTCGTCTTCGTCGTCGGACGGGCTGGGAGAGGCCAGC
ACGCTCAAGGAGGGAGAAGGGCTCACGATAGAGTCGAGCTCCAGAGGGCAGATGTAG
Gene >Ophio5|639
ATGTGGCGCTACCAGCCACGACAATGTAACTTTGGGCACCTTGGATGGATGATGGACCTCGGCTGCAATAGTGTC
AGCCTCGGTCCGTTTCCCCAAGCACACCTTATTACGCCGTTGCTCGACTCGCCCGTCAAACCAAGTGGCTTTGAC
TTCGGCCTCGCTACGTTCAAGACTCTTGCTGCATTTTGTCGCCACTGTCTCCCCCTCTTTCCCTCCTCCTGGTTG
ACTGACGAGGCTCTTTGGCAGCTTCCGCAGGCCAAGCAGACGTCGCCATGGCGGGAAGGGTACGGCAGCCCATCG
ACGAGGCGGCCCTGGAGCGCTATCTCGACAACAAGGTCCCCCAGATCAAGAGGCCCGTGGAGGTGAAGCAGGTCA
GTCTAGCGATGAACTCGGCAACGCTCACGCTCACCCGGACAGTTCGGCTTCGGCCAATCCAATCCAACGTACCTG
GTGACGGGCGCCGACGGGCAGCGGCTCGTGTTACGAAAAAAGCCACCGGGCAAGCTCCTCTCCCAAACGGCGCAC
AAGGTGGAGCGCGAATATCGCATCATGCGTGGGCTCGACGCTACGGCCGTACCGGTTCCCAAGGCGTACTGCCTG
TGCGAGGAGGCGTCGGTCATCGGCACGCCCTTCTACCTCATGGAGTTCCTCGACGGGCGCATCTTTGAGGACTTC
GCCATGCCCGGCGTCAGCGCCGACGAGCGGACCAAACTATGGCGGGCGGCGACGGAGACGCTGGCCAGGCTGCAC
GCCGTCGATTTCAACAGTATCGGGCTGGCCGACTTTGGGAAGCACGCCGGCTTCTACGGTCGCCAGGTGCAGACG
TGGAGCACCATCTGCGCCAAGCAAGAGATGGTGGCCGACGTCGAGACGGGCGAGCCGGTGGGAAGGCTACCGCAC
CAGGATGACATGGTGCGATTCTTCAGCGACGAAAGGCTGCGGCCGCGGGACAGGGCGACGCTGGTGCATGGCGAC
TTTAAGATTGACAACCTCGTCTTTCACAAGACGGAAGCGCGGGTCATTGGCATACTGGAGTAGGACAAAGCACTC
CCCACGCTTCCCTTCACACTGGCTGACGGAGTGGCATGACAGCTGGGAAATGTCGACGATCGGGCACCCGCTGTC
GGACGTGTGCAACTTCCTGACGCACTTCTACACGGCCGCGCAGCCGCAGATGGGCCGCTTCTCGGCCAAGGGATT
TCTGCCGGGCCAGACGCCCGGGCTGCCGACGGCAGAGCAGATGGTGAGGTGGTACGGCGAAGCATCGGGCTACGA
CCCGAGCCGGGATCTGACGTGGGGGATGGCCTTTAACATATTCCGGGCGGCGGCGGTCGCTCAAGGCATCGCGGC
CCGTCAAGCGACGCGGCAAGCCAGCAGCGAGCAGGCCCGGGAATATGCGGCGGCGAGGGGAGCGCTGGCCGAGCT
GGCCTGGAAGCTGGTGCAGGAGGCGGCGAGGTCGGAGAGGGGATCACGGCTGTAGCGTTGAGGCTGTCGTCAGTC
AATGCCATTGTCCAATGACACACAAGCAATCCAGGCCGCATGAAAGCCAGCTCATCAGACGGTCCGGCCAATAGC
AGGCGACGACGACCCGACGCATTGTCCTTGATTTTCCTTTGCCACCATGAAAAGAGGGTGAAGACGGAAAGTTTA
ACGCTAGACTTGTTTCCCTTCTTTAACCCCCGTGGCTTGTTGTTTGCGTCTGTGGCAAAATTCCGCTCGTGTAGG
TAGGTGTAGTACAGTGTTTTTTTTTTTCAATCTACCCGACGACGTTGTCTCACCGCCATACGAGGCCGACATCGC
TCCATCTCGTCATCGTCATCGTCTTCCTCCCTCCTTCCTCCCTCCCCTCCCTCGTCTTCTCCTCCTTTTTCTCTT
TCCCACTCACCCGTCCTTCCATCGCAGGCCATCATGGCGGATCGCAGGCGGCACATCACCTTGCCGCCGCCGCTT
CCGCCTCAACTTCCGCCGCCCTCGTCTTCTCCTCATTCTTCTCACCCTCTCGGCGGAGAGCATCGGCCACTGCTG
CCTCGCCAAAGCAACAATGACGAGGATCAGGTCTACAGCTGCATGTCGAATCCGCACAGCCATCTTCCCGTCTAC
ACCAACATCCATCGTATCCGGCGCGACATCACCAGCGTCGTCGAGGATCACCTGAGCCTCGAGCAGTTGCGCGAC
GTACGCATCAACGTCACCGTCGTCCGGCCCTTGGTCGACAAGTTCTACGAACTCGGAGACGTCTCCATCGGTGAG
CGCGCCCTCCTCTTCTCTTCCCCCTTGTCGTTCAGACGGTTGACGACGCTCTTCTCTTCTTCCCCTCCCGCTCTC
TCTTCTTCAGTCTATTGCTTGCTGGTAAATCGTGCCCAGTTTCTGATGGAGGAGTCCCAGTCGAGTAACCGCCAA
AACGTCAACTGGTCGCGCGCCACCCTGTGTGAGCTCATCGCCACCCGCATCCTCAGGCGTTTCGGCGAGGACTAT
GTTGGTACCGACGGCTTGCTGCTTCTGGCCCATGTCCTGGTCGCCGGCTTCCATCCCTTTCAGAATGCGCCGCTC
AACATTCGTGACGAGGTCTCGGCTCAATCGCCTTGGAAGCATCATCGCACCTTGCCCGCTCTCGAGCTGGCCATC
ATCACCGAGAGCAAGCACTTCCTCAGCTCCTCGACCTGCCAGCGCGTCGTCTCCGCCATCTACGACGGTCGCATC
ATCTACACGCCCTCGACCTTTTGGGACATCATCCCCGACCACTACAAACTCAAGCCCATATCCCTCTATGACCCC
CGCGAGTCGCCCCTGCTCAATCAGTATCGTCTGATCGTGCCCCGCACACGCACCATCCTCGAGGCCATCCAATTC
GCCATTCTGCTGGGCCTGTACGTGGGCGTCATGCTCCGACGGGGCAAGGGCAGCATCACTCCACTGGAGACCATC
TTCGCTGTTTATGCCTTTGGCTGGGGACTGGATCAACTGGCCACCATCATGGCCCACGGCTGGTGAGATGCCCTC
TCCCTGCGCCCTCAAAGGCTCCTCGTGTCTCATGTGGTCTGACTGCCCCGTTGCAGGGACGTCTATACCCAGAAC
CTGTGGTCCTTTCTCGACGTCACCTTCACCTGCATCTTCTCCGTCTATCTGGTGATCCGGCTTCACGGGCTGCGA
CTGGGCGATCCCAGCTACGCCCAACAGGCCTATGATGTTTTGGCACTGGCAGCCCCCGTCTTGGTACCTCGCCTC
GCCTTTATTCTTCTGTCGGACAATCTGATCTTCCTATCTCTGCGGTCCATGATGGCCGACTTTTTCCTTCTGACG
GCGCTGTCTGCCTGGTGCTTCTTTGGATTCTTGCTCTCGCTGCGGTGGCTGGGAGAGGGCATCCATCCTCTGGTG
TGAGTTCTGTCAAAAGATGAACGGTCGTGGAACAGCTGGGCTGACGGATAGGAAACTAGCACGATATCCAAGTGG
ATGATTTACATCTGGTTCGGCCTCGATGGCACCGGCATCCAGCGTTCGGTAAGCCACTCTCTATGACGCTCTCGA
CACGGCATCTGACGCAGGTGCAAGACGGAGTTCCACTGGCTGTACGGGCCCTGCATCATGATCGCCTTTGCTTTC
CTCGGCAACACTCTCTTCCTCACCATCCTCGTCTCGATGCTCTCAAATACGTTCAGCAACATCTCGACCAACGCC
ATGGCGGAGATGCAGTTCCGCCGGGCGGTGCTGACGCTCGAGGGCGTCAAGGCCGACGCCATCTTCGCCTATCAG
CCGCCCTTTAACCTCTTGGCCGTCTTCATGCTCCTACCGCTCAAGTTCATCGTCAGCCCTCGCTGGTTCCACAAG
ATCCACGTGACCATGGTGCGGCTGGTGAACCTCCCGCTGCTGCTCGTCATCGCCGTCGCTGAGCGCCGTCTGCTC
TGGTCGGCGGGCGAGCATGAATCGGTGCGGCCGACGATGAGGCGCCGACTCTGGCGCAAGTGGAAGGTGTCGACG
CATAGAGATATTCGAGACGTTTTTAGCGTGCCGCCGCCGGACGACGTGCACGACGATATTGCCGTCGACGACGAC
CTGACGCATCATCTCATCCGGCGGCAATTCACGCGGCAGAACACGACGACGGACGTACAGCCGCGAAAGCCGTCG
CGCAGGGACTCGATGTTTCCGGGTCTCGCCAGTAAGCTGCGCGGCTCCTTTACCGAGGAGAGCGAAGATCAGGGG
GCCTTGGCGGCCAGGGTGGAATCGATGGAGAAGTCGCTACAGCGCATGGAAGGCATGCTTTCGAGGCTGGTCCCG
GACGACTCGGCGTCGTCTTCGTCGTCGGACGGGCTGGGAGAGGCCAGCACGCTCAAGGAGGGAGAAGGGCTCACG
ATAGAGTCGAGCTCCAGAGGGCAGATGTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail