Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|6388
Gene name
Locationscaffold_558:3178..6185
Strand-
Gene length (bp)3007
Transcript length (bp)2628
Coding sequence length (bp)2625
Protein length (aa) 875

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00654 Voltage_CLC Voltage gated chloride channel 4.5E-80 309 686

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9R279|CLCN3_CAVPO H(+)/Cl(-) exchange transporter 3 OS=Cavia porcellus GN=CLCN3 PE=2 SV=1 121 869 7.0E-137
sp|P51792|CLCN3_RAT H(+)/Cl(-) exchange transporter 3 OS=Rattus norvegicus GN=Clcn3 PE=2 SV=2 121 869 1.0E-136
sp|P51791|CLCN3_MOUSE H(+)/Cl(-) exchange transporter 3 OS=Mus musculus GN=Clcn3 PE=1 SV=2 121 869 1.0E-136
sp|O18894|CLCN3_RABIT H(+)/Cl(-) exchange transporter 3 OS=Oryctolagus cuniculus GN=CLCN3 PE=2 SV=3 121 869 2.0E-136
sp|P51790|CLCN3_HUMAN H(+)/Cl(-) exchange transporter 3 OS=Homo sapiens GN=CLCN3 PE=1 SV=2 121 869 2.0E-136
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9R279|CLCN3_CAVPO H(+)/Cl(-) exchange transporter 3 OS=Cavia porcellus GN=CLCN3 PE=2 SV=1 121 869 7.0E-137
sp|P51792|CLCN3_RAT H(+)/Cl(-) exchange transporter 3 OS=Rattus norvegicus GN=Clcn3 PE=2 SV=2 121 869 1.0E-136
sp|P51791|CLCN3_MOUSE H(+)/Cl(-) exchange transporter 3 OS=Mus musculus GN=Clcn3 PE=1 SV=2 121 869 1.0E-136
sp|O18894|CLCN3_RABIT H(+)/Cl(-) exchange transporter 3 OS=Oryctolagus cuniculus GN=CLCN3 PE=2 SV=3 121 869 2.0E-136
sp|P51790|CLCN3_HUMAN H(+)/Cl(-) exchange transporter 3 OS=Homo sapiens GN=CLCN3 PE=1 SV=2 121 869 2.0E-136
sp|Q9TTU3|CLCN5_RABIT H(+)/Cl(-) exchange transporter 5 OS=Oryctolagus cuniculus GN=CLCN5 PE=2 SV=1 121 870 3.0E-128
sp|Q99P66|CLCN5_CAVPO H(+)/Cl(-) exchange transporter 5 OS=Cavia porcellus GN=CLCN5 PE=2 SV=1 121 870 2.0E-127
sp|Q5RDJ7|CLCN3_PONAB H(+)/Cl(-) exchange transporter 3 OS=Pongo abelii GN=CLCN3 PE=2 SV=1 121 869 3.0E-127
sp|Q5RBK4|CLCN5_PONAB H(+)/Cl(-) exchange transporter 5 OS=Pongo abelii GN=CLCN5 PE=2 SV=1 121 870 2.0E-125
sp|P51795|CLCN5_HUMAN H(+)/Cl(-) exchange transporter 5 OS=Homo sapiens GN=CLCN5 PE=1 SV=1 121 870 2.0E-125
sp|P51793|CLCN4_HUMAN H(+)/Cl(-) exchange transporter 4 OS=Homo sapiens GN=CLCN4 PE=1 SV=2 104 870 2.0E-125
sp|Q9GKE7|CLCN5_PIG H(+)/Cl(-) exchange transporter 5 OS=Sus scrofa GN=CLCN5 PE=2 SV=1 121 870 4.0E-125
sp|P51796|CLCN5_RAT H(+)/Cl(-) exchange transporter 5 OS=Rattus norvegicus GN=Clcn5 PE=2 SV=1 121 870 9.0E-125
sp|Q9WVD4|CLCN5_MOUSE H(+)/Cl(-) exchange transporter 5 OS=Mus musculus GN=Clcn5 PE=1 SV=1 121 870 3.0E-124
sp|P51794|CLCN4_RAT H(+)/Cl(-) exchange transporter 4 OS=Rattus norvegicus GN=Clcn4 PE=2 SV=1 121 870 4.0E-123
sp|Q61418|CLCN4_MOUSE H(+)/Cl(-) exchange transporter 4 OS=Mus musculus GN=Clcn4 PE=2 SV=2 121 870 2.0E-122
sp|P0C197|CLCNX_USTMA Probable chloride channel protein UM03490-D OS=Ustilago maydis (strain 521 / FGSC 9021) GN=UMAG_11084 PE=3 SV=1 310 807 2.0E-90
sp|O60159|YHYB_SCHPO Putative anion/proton exchange transporter C19C7.11 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC19C7.11 PE=3 SV=2 310 875 1.0E-68
sp|P37020|GEF1_YEAST Anion/proton exchange transporter GEF1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GEF1 PE=1 SV=2 115 868 4.0E-68
sp|Q54AX6|CLCA_DICDI Chloride channel protein A OS=Dictyostelium discoideum GN=clcA PE=2 SV=1 310 797 2.0E-47
sp|O94287|YOO2_SCHPO Uncharacterized chloride channel protein C887.02 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC887.02 PE=3 SV=2 309 869 3.0E-47
sp|Q75JF3|CLCC_DICDI Chloride channel protein C OS=Dictyostelium discoideum GN=clcC PE=3 SV=1 310 709 2.0E-46
sp|P35525|CLCN2_RAT Chloride channel protein 2 OS=Rattus norvegicus GN=Clcn2 PE=1 SV=1 300 789 3.0E-45
sp|P51788|CLCN2_HUMAN Chloride channel protein 2 OS=Homo sapiens GN=CLCN2 PE=1 SV=2 300 789 1.0E-44
sp|Q9R0A1|CLCN2_MOUSE Chloride channel protein 2 OS=Mus musculus GN=Clcn2 PE=1 SV=2 300 789 2.0E-44
sp|Q86AZ6|CLCB_DICDI Chloride channel protein B OS=Dictyostelium discoideum GN=clcB PE=3 SV=1 310 709 6.0E-44
sp|P51789|CLCN2_RABIT Chloride channel protein 2 OS=Oryctolagus cuniculus GN=CLCN2 PE=2 SV=1 300 789 7.0E-44
sp|Q54C67|CLCF_DICDI Chloride channel protein F OS=Dictyostelium discoideum GN=clcF PE=3 SV=1 309 779 9.0E-44
sp|Q9WU45|CLCN2_CAVPO Chloride channel protein 2 OS=Cavia porcellus GN=CLCN2 PE=2 SV=1 300 724 2.0E-43
sp|Q9BMK9|CLH3_CAEEL Chloride channel protein clh-3 OS=Caenorhabditis elegans GN=clh-3 PE=1 SV=1 309 706 4.0E-42
sp|Q64347|CLCN1_MOUSE Chloride channel protein 1 OS=Mus musculus GN=Clcn1 PE=1 SV=3 309 803 1.0E-41
sp|P35524|CLCN1_RAT Chloride channel protein 1 OS=Rattus norvegicus GN=Clcn1 PE=1 SV=1 309 803 1.0E-41
sp|P35523|CLCN1_HUMAN Chloride channel protein 1 OS=Homo sapiens GN=CLCN1 PE=1 SV=3 305 784 2.0E-40
sp|Q9VGH7|CLCN2_DROME Chloride channel protein 2 OS=Drosophila melanogaster GN=ClC-a PE=2 SV=3 300 706 2.0E-40
sp|Q9MZT1|CLCN1_CANLF Chloride channel protein 1 OS=Canis lupus familiaris GN=CLCN1 PE=1 SV=1 309 784 5.0E-39
sp|P92942|CLCB_ARATH Chloride channel protein CLC-b OS=Arabidopsis thaliana GN=CLC-B PE=1 SV=1 309 712 5.0E-39
sp|P92941|CLCA_ARATH Chloride channel protein CLC-a OS=Arabidopsis thaliana GN=CLC-A PE=1 SV=2 305 858 7.0E-38
sp|P35522|CICH_TORCA Chloride channel protein OS=Torpedo californica PE=1 SV=3 309 706 3.0E-37
sp|P21564|CICH_TORMA Chloride channel protein OS=Torpedo marmorata PE=1 SV=1 309 706 5.0E-37
sp|O70496|CLCN7_MOUSE H(+)/Cl(-) exchange transporter 7 OS=Mus musculus GN=Clcn7 PE=1 SV=1 310 866 2.0E-36
sp|P51799|CLCN7_RAT H(+)/Cl(-) exchange transporter 7 OS=Rattus norvegicus GN=Clcn7 PE=2 SV=1 310 866 2.0E-36
sp|P92943|CLCD_ARATH Chloride channel protein CLC-d OS=Arabidopsis thaliana GN=CLC-D PE=1 SV=2 309 875 2.0E-36
sp|Q96282|CLCC_ARATH Chloride channel protein CLC-c OS=Arabidopsis thaliana GN=CLC-C PE=1 SV=1 309 764 2.0E-36
sp|Q9TT16|CLCN6_RABIT Chloride transport protein 6 OS=Oryctolagus cuniculus GN=CLCN6 PE=2 SV=1 310 707 9.0E-34
sp|Q9W701|CLCKB_XENLA Chloride channel protein ClC-Kb OS=Xenopus laevis GN=clcnkb PE=1 SV=1 310 870 4.0E-33
sp|Q4PKH3|CLCN7_BOVIN H(+)/Cl(-) exchange transporter 7 OS=Bos taurus GN=CLCN7 PE=2 SV=1 310 866 7.0E-33
sp|O35454|CLCN6_MOUSE Chloride transport protein 6 OS=Mus musculus GN=Clcn6 PE=1 SV=1 310 707 7.0E-33
sp|P51797|CLCN6_HUMAN Chloride transport protein 6 OS=Homo sapiens GN=CLCN6 PE=1 SV=2 310 707 2.0E-32
sp|P51798|CLCN7_HUMAN H(+)/Cl(-) exchange transporter 7 OS=Homo sapiens GN=CLCN7 PE=1 SV=2 310 872 2.0E-31
sp|P60300|CLCG_ARATH Putative chloride channel-like protein CLC-g OS=Arabidopsis thaliana GN=CBSCLC6 PE=3 SV=2 309 849 3.0E-28
sp|Q54LQ4|CLCE_DICDI Chloride channel protein E OS=Dictyostelium discoideum GN=clcE PE=3 SV=1 310 710 7.0E-28
sp|P51803|CLCKA_RABIT Chloride channel protein ClC-Ka OS=Oryctolagus cuniculus GN=CLCNKA PE=2 SV=1 310 856 2.0E-26
sp|P51804|CLCKB_RABIT Chloride channel protein ClC-Kb OS=Oryctolagus cuniculus GN=CLCNKB PE=2 SV=1 310 853 4.0E-26
sp|Q1ZXJ0|CLCD_DICDI Chloride channel protein D OS=Dictyostelium discoideum GN=clcD PE=3 SV=1 526 865 1.0E-21
sp|Q1ZXJ0|CLCD_DICDI Chloride channel protein D OS=Dictyostelium discoideum GN=clcD PE=3 SV=1 306 519 7.0E-21
sp|Q9WUB6|CLCKB_MOUSE Chloride channel protein ClC-Kb OS=Mus musculus GN=Clcnkb PE=1 SV=2 309 754 7.0E-19
sp|Q9WUB7|CLCKA_MOUSE Chloride channel protein ClC-Ka OS=Mus musculus GN=Clcnka PE=1 SV=2 310 754 8.0E-19
sp|Q06393|CLCKA_RAT Chloride channel protein ClC-Ka OS=Rattus norvegicus GN=Clcnka PE=1 SV=3 310 856 2.0E-18
sp|P51802|CLCKB_RAT Chloride channel protein ClC-Kb OS=Rattus norvegicus GN=Clcnkb PE=1 SV=1 309 754 1.0E-17
sp|P51800|CLCKA_HUMAN Chloride channel protein ClC-Ka OS=Homo sapiens GN=CLCNKA PE=1 SV=1 309 754 2.0E-17
sp|P51801|CLCKB_HUMAN Chloride channel protein ClC-Kb OS=Homo sapiens GN=CLCNKB PE=1 SV=3 309 856 2.0E-17
sp|B5Y1L4|CLCA_KLEP3 H(+)/Cl(-) exchange transporter ClcA OS=Klebsiella pneumoniae (strain 342) GN=clcA PE=3 SV=1 310 695 5.0E-12
sp|A7MGR4|CLCA_CROS8 H(+)/Cl(-) exchange transporter ClcA OS=Cronobacter sakazakii (strain ATCC BAA-894) GN=clcA PE=3 SV=1 309 695 5.0E-12
sp|A8ALD3|CLCA_CITK8 H(+)/Cl(-) exchange transporter ClcA OS=Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696) GN=clcA PE=3 SV=1 310 695 7.0E-12
sp|Q8ZRP8|CLCA_SALTY H(+)/Cl(-) exchange transporter ClcA OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=clcA PE=1 SV=1 310 695 4.0E-11
sp|A9N0Q1|CLCA_SALPB H(+)/Cl(-) exchange transporter ClcA OS=Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7) GN=clcA PE=3 SV=1 310 695 5.0E-11
sp|B4SUY5|CLCA_SALNS H(+)/Cl(-) exchange transporter ClcA OS=Salmonella newport (strain SL254) GN=clcA PE=3 SV=1 310 695 5.0E-11
sp|B5R3G7|CLCA_SALEP H(+)/Cl(-) exchange transporter ClcA OS=Salmonella enteritidis PT4 (strain P125109) GN=clcA PE=3 SV=1 310 695 5.0E-11
sp|Q8Z9B3|CLCA_SALTI H(+)/Cl(-) exchange transporter ClcA OS=Salmonella typhi GN=clcA PE=3 SV=1 310 695 6.0E-11
sp|B4TXQ7|CLCA_SALSV H(+)/Cl(-) exchange transporter ClcA OS=Salmonella schwarzengrund (strain CVM19633) GN=clcA PE=3 SV=1 310 695 6.0E-11
sp|C0Q5R6|CLCA_SALPC H(+)/Cl(-) exchange transporter ClcA OS=Salmonella paratyphi C (strain RKS4594) GN=clcA PE=3 SV=1 310 695 7.0E-11
sp|Q57T52|CLCA_SALCH H(+)/Cl(-) exchange transporter ClcA OS=Salmonella choleraesuis (strain SC-B67) GN=clcA PE=3 SV=1 310 695 7.0E-11
sp|B4TK31|CLCA_SALHS H(+)/Cl(-) exchange transporter ClcA OS=Salmonella heidelberg (strain SL476) GN=clcA PE=3 SV=1 310 695 7.0E-11
sp|B5FJ02|CLCA_SALDC H(+)/Cl(-) exchange transporter ClcA OS=Salmonella dublin (strain CT_02021853) GN=clcA PE=3 SV=1 310 695 7.0E-11
sp|B5F8R6|CLCA_SALA4 H(+)/Cl(-) exchange transporter ClcA OS=Salmonella agona (strain SL483) GN=clcA PE=3 SV=1 310 695 7.0E-11
sp|B5RHE1|CLCA_SALG2 H(+)/Cl(-) exchange transporter ClcA OS=Salmonella gallinarum (strain 287/91 / NCTC 13346) GN=clcA PE=3 SV=1 310 695 8.0E-11
sp|Q8XTT4|CLCL_RALSO Putative chloride channel protein ClcB-like OS=Ralstonia solanacearum (strain GMI1000) GN=RSp0020 PE=3 SV=2 329 694 1.0E-10
sp|A9MPK6|CLCA_SALAR H(+)/Cl(-) exchange transporter ClcA OS=Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980) GN=clcA PE=3 SV=1 310 695 2.0E-10
sp|B5BL83|CLCA_SALPK H(+)/Cl(-) exchange transporter ClcA OS=Salmonella paratyphi A (strain AKU_12601) GN=clcA PE=3 SV=1 310 695 2.0E-10
sp|Q5PD50|CLCA_SALPA H(+)/Cl(-) exchange transporter ClcA OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=clcA PE=3 SV=1 310 695 2.0E-10
sp|Q8ZEB3|CLCB_YERPE Voltage-gated ClC-type chloride channel ClcB OS=Yersinia pestis GN=clcB PE=3 SV=2 337 694 2.0E-09
sp|A6T4V9|CLCA_KLEP7 H(+)/Cl(-) exchange transporter ClcA OS=Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578) GN=clcA PE=3 SV=1 310 695 2.0E-09
sp|Q9AGD5|CLCB_YERPS Voltage-gated ClC-type chloride channel ClcB OS=Yersinia pseudotuberculosis serotype I (strain IP32953) GN=clcB PE=3 SV=3 337 694 5.0E-09
sp|A7FHW4|CLCB_YERP3 Voltage-gated ClC-type chloride channel ClcB OS=Yersinia pseudotuberculosis serotype O:1b (strain IP 31758) GN=clcB PE=3 SV=1 337 694 5.0E-09
sp|A7FM08|CLCA_YERP3 H(+)/Cl(-) exchange transporter ClcA OS=Yersinia pseudotuberculosis serotype O:1b (strain IP 31758) GN=clcA PE=3 SV=1 334 481 2.0E-06
sp|B2K549|CLCA_YERPB H(+)/Cl(-) exchange transporter ClcA OS=Yersinia pseudotuberculosis serotype IB (strain PB1/+) GN=clcA PE=3 SV=1 334 481 2.0E-06
sp|B1JK21|CLCA_YERPY H(+)/Cl(-) exchange transporter ClcA OS=Yersinia pseudotuberculosis serotype O:3 (strain YPIII) GN=clcA PE=3 SV=1 334 481 2.0E-06
sp|A4TPW7|CLCA_YERPP H(+)/Cl(-) exchange transporter ClcA OS=Yersinia pestis (strain Pestoides F) GN=clcA PE=3 SV=1 334 481 2.0E-06
sp|Q1CLU6|CLCA_YERPN H(+)/Cl(-) exchange transporter ClcA OS=Yersinia pestis bv. Antiqua (strain Nepal516) GN=clcA PE=3 SV=1 334 481 2.0E-06
sp|A9R1E4|CLCA_YERPG H(+)/Cl(-) exchange transporter ClcA OS=Yersinia pestis bv. Antiqua (strain Angola) GN=clcA PE=3 SV=1 334 481 2.0E-06
sp|Q8ZBM0|CLCA_YERPE H(+)/Cl(-) exchange transporter ClcA OS=Yersinia pestis GN=clcA PE=3 SV=1 334 481 2.0E-06
sp|Q1C3X2|CLCA_YERPA H(+)/Cl(-) exchange transporter ClcA OS=Yersinia pestis bv. Antiqua (strain Antiqua) GN=clcA PE=3 SV=1 334 481 2.0E-06
sp|Q87WD2|ERIC_PSESM Chloride/fluoride channel protein OS=Pseudomonas syringae pv. tomato (strain DC3000) GN=eriC PE=1 SV=1 340 511 9.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0055085 transmembrane transport Yes
GO:0016020 membrane Yes
GO:0005247 voltage-gated chloride channel activity Yes
GO:0006821 chloride transport Yes
GO:0051234 establishment of localization No
GO:0008150 biological_process No
GO:0005215 transporter activity No
GO:0003674 molecular_function No
GO:0051179 localization No
GO:0005244 voltage-gated ion channel activity No
GO:0006810 transport No
GO:0015075 ion transmembrane transporter activity No
GO:0005254 chloride channel activity No
GO:0015103 inorganic anion transmembrane transporter activity No
GO:0005216 ion channel activity No
GO:0022803 passive transmembrane transporter activity No
GO:0022832 voltage-gated channel activity No
GO:0008509 anion transmembrane transporter activity No
GO:0022857 transmembrane transporter activity No
GO:0110165 cellular anatomical entity No
GO:0015267 channel activity No
GO:0006820 anion transport No
GO:0009987 cellular process No
GO:0015108 chloride transmembrane transporter activity No
GO:0005575 cellular_component No
GO:0015698 inorganic anion transport No
GO:0006811 ion transport No
GO:0015318 inorganic molecular entity transmembrane transporter activity No
GO:0022836 gated channel activity No
GO:0005253 anion channel activity No
GO:0008308 voltage-gated anion channel activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.45

Transmembrane Domains

Domain # Start End Length
1 154 176 22
2 234 254 20
3 325 347 22
4 357 374 17
5 387 409 22
6 424 441 17
7 461 480 19
8 500 522 22
9 569 591 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
SC16a Pure fungal culture 79.02 41.01 117.03
CcL In ants, during behavior modification 145.53 57.41 233.64
CcD In ants, recently dead 65.98 35.06 96.90

Differential expression

Label1 Label2 Q-value Significant difference
SC16a CcL 0.017022 yes
SC16a CcD 0.486087 no
CcL CcD 0.001437 yes

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|6388
MADREPPDGYSPPSSPLMMRQPPSNRRRHSSDEPNERSALLAPPPPMTTTTRPRVRIRSGADSPRLPSLSRTQSY
AGSYLGARHHNRHESLSQRLISAFADGRGSFSGSKSSMFIDERVWYDQFTSTDWVHDAIADSHRVKALRSRKGFW
GRIAILFDGVQGWILSALSGFIIALIAYTVDVSEATVFDYKDGYCAKAWYLGEQKCCPRGPCDDWKNWSEVITFS
PLGPGWTEFTIYMSGVVGFAVFSCWLALWTETVVPSAYRLTTLDENLAAVSPPQVLEDGQTDDSASPRRRGEAEA
GNPPMVYYSAAGSGVAEVRVILSGFVLHGFLGFKTLVIKMLSLVFSVSSGLSLGKEGPFVHMATCVGNIACRLFP
KYDQNDAKRREALSAAAAAGVAVAFGAPLGGVLFGLEEVAYFFPAKTLFRTFFCCIVAALSLKFLNPYGTHKIVM
FEVRYLVDWEFFELLGFIFVGVLGGAIGALFIKAHKHWAHSFRRIRVIKAYPMFEVFLVAVITGLMSYWNVLTKL
PVAKLLFNLASPCDYSADGYEDELGLCSNSVEDIPRIIRNLLIAFIVKGFLTVITFGIKVPSGIYIPSMVVGGLM
GRIVGHLVQWMVLSAPHWRIFHGCATAVEGSCIQPGVYGLIAAGATMCGTTRLSVTLAVILFELTGSLDYVLPFS
LSVLVSKWTADAIEPHSIYDLLTSMNSYPFLDNKRKPIFTSDLEDIVPRLRRERVIDITDSPLVSASSLRTKLEV
LHRSAELDGGLPIVRRGVLVGLIPAPDLEYALDQLEDEETSMCLMDRVPSIDDDDVCDADPTDFARYIDPAPVAL
DIRSPMDLVYECFVKLGLRYICVLKDGKYAGMTHKKTFVKYMRQLEEAGD
Coding >Ophio5|6388
ATGGCTGACCGGGAGCCGCCCGACGGTTACTCTCCGCCATCATCTCCTCTAATGATGCGCCAACCTCCCTCCAAC
CGCCGTCGCCATTCGAGCGACGAGCCCAACGAGCGTTCTGCACTCCTGGCGCCACCCCCGCCGATGACGACGACG
ACGAGGCCCCGAGTCCGCATCCGCAGCGGCGCCGACTCTCCCCGTCTGCCTTCTCTTTCTCGAACCCAAAGCTAT
GCGGGGAGCTACCTCGGCGCGCGACACCATAATCGACACGAGTCACTGAGCCAGAGGCTAATTTCAGCCTTTGCC
GACGGGCGTGGATCCTTTTCGGGATCCAAGAGCTCCATGTTCATCGACGAACGAGTTTGGTACGATCAGTTTACC
AGCACCGACTGGGTACACGATGCCATTGCCGATTCCCATCGCGTCAAGGCTCTCCGCAGCAGAAAAGGCTTCTGG
GGCCGTATCGCCATACTGTTTGACGGCGTCCAGGGATGGATTCTCAGCGCCCTCTCGGGATTCATCATTGCCCTC
ATTGCCTACACCGTCGACGTGAGCGAAGCCACCGTTTTCGATTACAAGGACGGCTACTGTGCCAAGGCGTGGTAC
CTCGGTGAGCAGAAATGCTGCCCCCGTGGCCCTTGCGACGATTGGAAGAACTGGTCCGAGGTCATTACCTTTAGC
CCCCTCGGGCCGGGATGGACCGAATTCACCATCTACATGTCGGGTGTCGTCGGCTTCGCCGTCTTTTCCTGCTGG
CTGGCCTTGTGGACCGAGACGGTAGTGCCATCGGCGTACCGTCTGACGACACTGGACGAGAACCTCGCGGCCGTG
AGCCCGCCTCAGGTACTGGAAGACGGCCAGACGGACGATTCGGCGAGCCCCCGCCGCCGTGGCGAGGCCGAGGCC
GGTAACCCACCCATGGTCTACTACTCGGCAGCGGGCAGCGGCGTGGCGGAGGTGCGCGTCATTCTCAGCGGTTTC
GTGTTGCACGGATTCCTCGGCTTCAAGACACTGGTCATCAAGATGCTGTCGCTCGTCTTCAGCGTCTCGTCCGGC
CTCAGTCTGGGAAAGGAGGGGCCCTTTGTCCACATGGCGACGTGTGTCGGCAATATCGCCTGCCGCTTGTTTCCC
AAGTACGACCAGAACGACGCCAAGCGGCGAGAGGCCCTTTCGGCAGCGGCAGCGGCGGGCGTCGCCGTCGCTTTC
GGCGCGCCGCTCGGAGGCGTCTTGTTCGGCCTCGAGGAGGTGGCCTACTTCTTTCCGGCGAAGACGCTGTTCAGG
ACCTTTTTCTGTTGCATCGTCGCCGCGCTGTCTCTCAAGTTCCTCAACCCCTACGGCACCCACAAGATCGTCATG
TTCGAGGTGCGCTACCTCGTGGACTGGGAGTTTTTCGAGTTGCTCGGCTTCATCTTCGTCGGCGTCCTGGGCGGC
GCCATCGGCGCGCTCTTCATCAAGGCGCACAAGCACTGGGCTCATAGCTTCCGCCGGATACGCGTCATCAAGGCC
TACCCTATGTTCGAAGTCTTTCTCGTCGCCGTCATCACGGGCCTCATGAGCTACTGGAACGTGCTGACGAAGCTG
CCCGTGGCCAAGCTGCTCTTCAACCTGGCGTCGCCCTGCGACTACTCGGCCGACGGTTACGAGGACGAGCTGGGC
CTGTGTTCGAATTCGGTCGAGGACATACCGCGCATCATACGAAACCTCTTGATCGCCTTTATCGTCAAGGGGTTT
CTCACTGTCATCACCTTCGGCATCAAAGTTCCATCGGGTATTTACATTCCGTCCATGGTGGTGGGCGGTCTGATG
GGCCGCATCGTCGGCCACCTCGTGCAATGGATGGTTCTGTCGGCGCCGCACTGGCGCATCTTTCACGGCTGTGCC
ACGGCCGTAGAGGGGAGTTGCATCCAGCCCGGCGTCTACGGCCTCATCGCCGCTGGAGCGACCATGTGCGGAACG
ACGAGGCTGTCGGTGACGCTGGCCGTGATTCTGTTTGAGCTGACGGGCAGCCTGGACTACGTGCTCCCGTTTTCT
CTATCCGTCTTGGTTTCCAAGTGGACGGCGGATGCCATTGAGCCGCACAGCATCTACGACCTCCTCACGAGCATG
AATTCGTACCCCTTCCTCGACAATAAGCGCAAGCCCATCTTCACCAGCGACTTGGAGGACATTGTGCCGCGGCTG
CGGCGGGAGCGGGTGATTGACATTACCGACTCGCCGCTCGTGTCGGCCTCGAGCCTCCGGACCAAGCTGGAGGTG
CTGCACCGGTCGGCCGAGCTCGACGGCGGGCTGCCCATTGTGCGACGCGGGGTGCTGGTCGGGCTCATCCCGGCG
CCAGACCTCGAGTACGCGCTGGATCAGCTGGAAGACGAGGAAACGAGCATGTGTCTCATGGATCGGGTACCGAGC
ATCGATGATGACGACGTGTGCGATGCCGACCCGACGGACTTTGCCCGGTACATAGATCCGGCTCCGGTGGCGCTA
GACATCAGGTCGCCCATGGACCTCGTGTACGAGTGTTTCGTCAAGCTGGGCCTGCGGTACATTTGCGTGCTGAAG
GACGGCAAATACGCGGGCATGACACACAAGAAGACGTTTGTCAAGTACATGAGGCAACTCGAAGAGGCTGGGGAC
Transcript >Ophio5|6388
ATGGCTGACCGGGAGCCGCCCGACGGTTACTCTCCGCCATCATCTCCTCTAATGATGCGCCAACCTCCCTCCAAC
CGCCGTCGCCATTCGAGCGACGAGCCCAACGAGCGTTCTGCACTCCTGGCGCCACCCCCGCCGATGACGACGACG
ACGAGGCCCCGAGTCCGCATCCGCAGCGGCGCCGACTCTCCCCGTCTGCCTTCTCTTTCTCGAACCCAAAGCTAT
GCGGGGAGCTACCTCGGCGCGCGACACCATAATCGACACGAGTCACTGAGCCAGAGGCTAATTTCAGCCTTTGCC
GACGGGCGTGGATCCTTTTCGGGATCCAAGAGCTCCATGTTCATCGACGAACGAGTTTGGTACGATCAGTTTACC
AGCACCGACTGGGTACACGATGCCATTGCCGATTCCCATCGCGTCAAGGCTCTCCGCAGCAGAAAAGGCTTCTGG
GGCCGTATCGCCATACTGTTTGACGGCGTCCAGGGATGGATTCTCAGCGCCCTCTCGGGATTCATCATTGCCCTC
ATTGCCTACACCGTCGACGTGAGCGAAGCCACCGTTTTCGATTACAAGGACGGCTACTGTGCCAAGGCGTGGTAC
CTCGGTGAGCAGAAATGCTGCCCCCGTGGCCCTTGCGACGATTGGAAGAACTGGTCCGAGGTCATTACCTTTAGC
CCCCTCGGGCCGGGATGGACCGAATTCACCATCTACATGTCGGGTGTCGTCGGCTTCGCCGTCTTTTCCTGCTGG
CTGGCCTTGTGGACCGAGACGGTAGTGCCATCGGCGTACCGTCTGACGACACTGGACGAGAACCTCGCGGCCGTG
AGCCCGCCTCAGGTACTGGAAGACGGCCAGACGGACGATTCGGCGAGCCCCCGCCGCCGTGGCGAGGCCGAGGCC
GGTAACCCACCCATGGTCTACTACTCGGCAGCGGGCAGCGGCGTGGCGGAGGTGCGCGTCATTCTCAGCGGTTTC
GTGTTGCACGGATTCCTCGGCTTCAAGACACTGGTCATCAAGATGCTGTCGCTCGTCTTCAGCGTCTCGTCCGGC
CTCAGTCTGGGAAAGGAGGGGCCCTTTGTCCACATGGCGACGTGTGTCGGCAATATCGCCTGCCGCTTGTTTCCC
AAGTACGACCAGAACGACGCCAAGCGGCGAGAGGCCCTTTCGGCAGCGGCAGCGGCGGGCGTCGCCGTCGCTTTC
GGCGCGCCGCTCGGAGGCGTCTTGTTCGGCCTCGAGGAGGTGGCCTACTTCTTTCCGGCGAAGACGCTGTTCAGG
ACCTTTTTCTGTTGCATCGTCGCCGCGCTGTCTCTCAAGTTCCTCAACCCCTACGGCACCCACAAGATCGTCATG
TTCGAGGTGCGCTACCTCGTGGACTGGGAGTTTTTCGAGTTGCTCGGCTTCATCTTCGTCGGCGTCCTGGGCGGC
GCCATCGGCGCGCTCTTCATCAAGGCGCACAAGCACTGGGCTCATAGCTTCCGCCGGATACGCGTCATCAAGGCC
TACCCTATGTTCGAAGTCTTTCTCGTCGCCGTCATCACGGGCCTCATGAGCTACTGGAACGTGCTGACGAAGCTG
CCCGTGGCCAAGCTGCTCTTCAACCTGGCGTCGCCCTGCGACTACTCGGCCGACGGTTACGAGGACGAGCTGGGC
CTGTGTTCGAATTCGGTCGAGGACATACCGCGCATCATACGAAACCTCTTGATCGCCTTTATCGTCAAGGGGTTT
CTCACTGTCATCACCTTCGGCATCAAAGTTCCATCGGGTATTTACATTCCGTCCATGGTGGTGGGCGGTCTGATG
GGCCGCATCGTCGGCCACCTCGTGCAATGGATGGTTCTGTCGGCGCCGCACTGGCGCATCTTTCACGGCTGTGCC
ACGGCCGTAGAGGGGAGTTGCATCCAGCCCGGCGTCTACGGCCTCATCGCCGCTGGAGCGACCATGTGCGGAACG
ACGAGGCTGTCGGTGACGCTGGCCGTGATTCTGTTTGAGCTGACGGGCAGCCTGGACTACGTGCTCCCGTTTTCT
CTATCCGTCTTGGTTTCCAAGTGGACGGCGGATGCCATTGAGCCGCACAGCATCTACGACCTCCTCACGAGCATG
AATTCGTACCCCTTCCTCGACAATAAGCGCAAGCCCATCTTCACCAGCGACTTGGAGGACATTGTGCCGCGGCTG
CGGCGGGAGCGGGTGATTGACATTACCGACTCGCCGCTCGTGTCGGCCTCGAGCCTCCGGACCAAGCTGGAGGTG
CTGCACCGGTCGGCCGAGCTCGACGGCGGGCTGCCCATTGTGCGACGCGGGGTGCTGGTCGGGCTCATCCCGGCG
CCAGACCTCGAGTACGCGCTGGATCAGCTGGAAGACGAGGAAACGAGCATGTGTCTCATGGATCGGGTACCGAGC
ATCGATGATGACGACGTGTGCGATGCCGACCCGACGGACTTTGCCCGGTACATAGATCCGGCTCCGGTGGCGCTA
GACATCAGGTCGCCCATGGACCTCGTGTACGAGTGTTTCGTCAAGCTGGGCCTGCGGTACATTTGCGTGCTGAAG
GACGGCAAATACGCGGGCATGACACACAAGAAGACGTTTGTCAAGTACATGAGGCAACTCGAAGAGGCTGGGGAC
TAG
Gene >Ophio5|6388
ATGGCTGACCGGGAGCCGCCCGACGGTTACTCTCCGCCATCATCTCCTCTAATGATGCGCCAACCTCCCTCCAAC
CGCCGTCGCCATTCGAGCGACGAGCCCAACGAGCGTTCTGCACTCCTGGCGCCACCCCCGCCGATGACGACGACG
ACGAGGCCCCGAGTCCGCATCCGCAGCGGCGCCGACTCTCCCCGTCTGCCTTCTCTTTCTCGAACCCAAAGCTAT
GCGGGCAAGCCAGCCTCTTCCTCGACTTGTTCTCATCCAGCTGCTGACCCCGATCTGGCTCATAGGGAGCTACCT
CGGCGCGCGACACCATAATCGACACGAGTCACTGAGCCAGAGGCTAATTTCAGCCTTTGCCGACGGGCGTGGATC
CTTTTCGGGATCCAAGAGCTCCATGTTCATCGACGAACGAGTTTGGTACGATCAGTTTACCAGCACCGACTGGGT
ACACGATGCCATTGCCGATTCCCATCGCGTCAAGGCTCTCCGCAGCAGAAAAGGCTTCTGGGGCCGTATCGCCAT
ACTGTTTGACGGCGTCCAGGGATGGATTCTCAGCGCCCTCTCGGGATTCATCATTGCCCTCATTGCCTACACCGT
CGACGTGAGCGAAGCCACCGTTTTCGATTACAAGGACGGCTACTGTGCCAAGGCGTGGTACCTCGGTGAGCAGGT
GAGGCATCCACTCCCAGGGCGCTTGATGGAGGGAGCCTTGGCACCTGCTTACGCTTCACAGAAATGCTGCCCCCG
TGGCCCTTGCGACGATTGGAAGAACTGGTCCGAGGTCATTACCTTTAGCCCCCTCGGGCCGGGATGGACCGAATT
CACCATCTACATGTCGGGTGTCGTCGGCTTCGCCGTCTTTTCCTGCTGGCTGGCCTTGTGGACCGAGACGGTAGT
GCCATCGGCGTACCGTCTGACGACACTGGACGAGAACCTCGCGGCCGTGAGCCCGCCTCAGGTACTGGAAGACGG
CCAGACGGACGATTCGGCGAGCCCCCGCCGCCGTGGCGAGGCCGAGGCCGGTAACCCACCCATGGTCTACTACTC
GGCAGCGGGCAGCGGCGTGGCGGAGGTGCGCGTCATTCTCAGCGGTTTCGTGTTGCACGGATTCCTCGGCTTCAA
GACACTGGTCATCAAGATGCTGTCGCTCGTCTTCAGCGTCTCGTCCGGCCTCAGTCTGGGAAAGGAGGGGCCCTT
TGTCCACATGGCGACGTGTGTCGGCAATATCGCCTGCCGCTTGTTTCCCAAGTACGACCAGAACGACGCCAAGCG
GCGAGAGGCCCTTTCGGCAGCGGCAGCGGCGGGCGTCGCCGTCGCTTTCGGCGCGCCGCTCGGAGGCGTCTTGTT
CGGCCTCGAGGAGGTGGCCTACTTCTTTCCGGCGAAGACGCTGTTCAGGACCTTTTTCTGTTGCATCGTCGCCGC
GCTGTCTCTCAAGTTCCTCAACCCCTACGGCACCCACAAGATCGTCATGTTCGAGGTGCGCTACCTCGTGGACTG
GGAGTTTTTCGAGTTGCTCGGCTTCATCTTCGTCGGCGTCCTGGGCGGCGCCATCGGCGCGCTCTTCATCAAGGC
GCACAAGCACTGGGCTCATAGCTTCCGCCGGATACGCGTCATCAAGGCCTACCCTATGTTCGAAGTCTTTCTCGT
CGCCGTCATCACGGGCCTCATGAGCTACTGGAACGTGCTGACGAAGCTGCCCGTGGCCAAGCTGCTCTTCAACCT
GGCGTCGCCCTGCGACTACTCGGCCGACGGTTACGAGGACGAGCTGGGCCTGTGTTCGAATTCGGTCGAGGACAT
ACCGCGCATCATACGAAACCTCTTGATCGCCTTTATCGTCAAGGGGTTTCTCACTGTCATCACCTTCGGCATCGT
GAGTAAAGCAGACGGCTGAGATAGGGGGGGGTTGTGACTGACAGATCGGACAGAAAGTTCCATCGGGTATTTACA
TTCCGTCCATGGTGGTGGGCGGTCTGATGGGCCGCATCGTCGGCCACCTCGTGCAATGGATGGTTCTGTCGGCGC
CGCACTGGCGCATCTTTCACGGCTGTGCCACGGCCGTAGAGGGGAGTTGCATCCAGCCCGGCGTCTACGGCCTCA
TCGCCGCTGGAGCGACCATGTGCGGAACGACGAGGCTGTCGGTGACGCTGGCCGTGATTCTGTTTGAGCTGACGG
GCAGCCTGGACTACGTGCTCCCGTTTTCTCTATCCGTCTTGGTTTCCAAGTGGACGGCGGATGCCATTGAGCCGC
ACAGCATCTACGTCAGCTCAGGTTTTCCCCCAAAAGAGGCGAGGCTCACCAGCTGACGACGACGCAGGACCTCCT
CACGAGCATGAATTCGTACCCCTTCCTCGACAATAAGCGCAAGCCCATCTTCACCAGCGACTTGGAGGACATTGT
GCCGCGGCTGCGGCGGGAGCGGGTGATTGACATTACCGACTCGCCGCTCGTGTCGGCCTCGAGCCTCCGGACCAA
GCTGGAGGTGCTGCACCGGTCGGCCGAGCTCGACGGCGGGCTGCCCATTGTGCGACGCGGGGTGCTGGTCGGGCT
CATCCCGGCGCCAGACCTCGAGTACGCGCTGGATCAGCTGGAAGACGAGGAAACGAGCATGTGTCTCATGGATCG
GGTACCGAGCATCGATGATGACGACGTGTGCGATGCCGACCCGACGGACTTTGCCCGGTACATAGATCCGGTGAG
TCGGCCGCGGGTCCCCGGAGAGAGGGGGGGAAGGAGAGCTGCTACTGACAGAAGTGTGTGTGTGTGTGTGTGGTG
TGGCAGGCTCCGGTGGCGCTAGACATCAGGTCGCCCATGGACCTCGTGTACGAGTGTTTCGTCAAGCTGGGCCTG
CGGTACATTTGCGTGCTGAAGGACGGCAAATACGCGGGCATGGTAAGCAGTGCGGGCTCTCACCATGCTACGTGG
TGTACTGACACGGACGACGATGCAGACACACAAGAAGACGTTTGTCAAGTACATGAGGCAACTCGAAGAGGCTGG
GGACTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail