Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|6370
Gene name
Locationscaffold_554:23..1599
Strand+
Gene length (bp)1576
Transcript length (bp)1506
Coding sequence length (bp)1503
Protein length (aa) 501

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF03372 Exo_endo_phos Endonuclease/Exonuclease/phosphatase family 3.2E-14 40 356

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O74369|CSS1_SCHPO Inositol phosphosphingolipids phospholipase C OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=css1 PE=1 SV=2 36 490 4.0E-76
sp|P40015|ISC1_YEAST Inositol phosphosphingolipids phospholipase C OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ISC1 PE=1 SV=1 37 489 4.0E-60
sp|Q9ET64|NSMA_RAT Sphingomyelin phosphodiesterase 2 OS=Rattus norvegicus GN=Smpd2 PE=1 SV=1 37 234 2.0E-31
sp|O60906|NSMA_HUMAN Sphingomyelin phosphodiesterase 2 OS=Homo sapiens GN=SMPD2 PE=1 SV=2 37 221 7.0E-31
sp|O70572|NSMA_MOUSE Sphingomyelin phosphodiesterase 2 OS=Mus musculus GN=Smpd2 PE=1 SV=1 37 221 2.0E-30
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O74369|CSS1_SCHPO Inositol phosphosphingolipids phospholipase C OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=css1 PE=1 SV=2 36 490 4.0E-76
sp|P40015|ISC1_YEAST Inositol phosphosphingolipids phospholipase C OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ISC1 PE=1 SV=1 37 489 4.0E-60
sp|Q9ET64|NSMA_RAT Sphingomyelin phosphodiesterase 2 OS=Rattus norvegicus GN=Smpd2 PE=1 SV=1 37 234 2.0E-31
sp|O60906|NSMA_HUMAN Sphingomyelin phosphodiesterase 2 OS=Homo sapiens GN=SMPD2 PE=1 SV=2 37 221 7.0E-31
sp|O70572|NSMA_MOUSE Sphingomyelin phosphodiesterase 2 OS=Mus musculus GN=Smpd2 PE=1 SV=1 37 221 2.0E-30
sp|Q9VZS6|NSMA_DROME Putative neutral sphingomyelinase OS=Drosophila melanogaster GN=CG12034 PE=2 SV=2 43 234 9.0E-29
sp|O45870|NSMA_CAEEL Putative neutral sphingomyelinase OS=Caenorhabditis elegans GN=T27F6.6 PE=3 SV=2 36 463 1.0E-25
[Show less]

GO

GO Term Description Terminal node
GO:0003824 catalytic activity Yes
GO:0003674 molecular_function No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 35 0.45

Transmembrane Domains

Domain # Start End Length
1 421 443 22
2 448 470 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|6370
MSRKDAAADVSSSMPDTEPRDDDDDDDDDGLLPPSELTLLTLNCWGLEHISSVRRQRLGEVGRRLARMRPRPQIV
CLQECWVESDFQAIREATRHLLPHAKMYRAGVFGAGLVILSRWPFQDSSMLIFPLNGRPTAFWRGDWYVGKGVAC
AVLRVGPAEGDVIHVFNTHTHAPYQKHHRDDSYACHRVAQAWEISKLLRTATATGRLVVALGDFNMLPLSLPHRI
ITSRAPVRDLWRVLHPHSSLGPARHPAEAARNRPVPGARFNLEENGATSDGLYNTWRWTKNAQNRLRAGRTPCPV
DPDAPDERGKRLDYIFASIGLTSPESASSSRRRWVVKSAAVTLTDPHPDLGVSLSDHFAVSATIRQHSAADGDDD
DDDDDEKSRLENNTTTTTLPLSAYDEILSLVDAYTARERSQRRYRALHFYAALVVWAACLVAVWFAPGNFVCFLL
ALVGSLVLAAGLIDGLLALLFFSSELRSLDEFAWEVRNARWAAAACPVKQK
Coding >Ophio5|6370
ATGTCACGCAAAGACGCTGCAGCCGACGTGTCCTCCTCCATGCCGGACACGGAACCTCGCGACGACGACGACGAC
GACGACGACGACGGCCTCCTCCCCCCGTCTGAACTGACGCTCCTGACGCTCAACTGCTGGGGCCTCGAGCACATC
TCCTCCGTCCGGAGGCAAAGACTGGGCGAGGTGGGCCGGCGGCTGGCTCGGATGCGGCCACGGCCTCAGATCGTC
TGCCTGCAGGAGTGCTGGGTGGAGAGCGATTTCCAGGCCATACGGGAGGCTACCCGTCACCTGTTGCCTCACGCC
AAGATGTACCGCGCCGGCGTCTTCGGTGCCGGTCTCGTCATACTCAGTCGTTGGCCCTTTCAGGATTCCTCCATG
CTCATCTTTCCCCTCAATGGCCGCCCTACCGCTTTTTGGAGGGGCGATTGGTATGTCGGCAAGGGCGTCGCCTGC
GCTGTCTTGAGGGTTGGCCCGGCTGAGGGGGACGTCATTCACGTCTTTAACACGCATACTCATGCCCCTTACCAA
AAACACCATCGCGACGACTCATACGCCTGCCACCGCGTCGCACAAGCATGGGAGATATCCAAGCTCCTCCGGACC
GCCACGGCAACAGGCCGTCTCGTCGTCGCCCTCGGCGACTTCAACATGCTCCCTCTCTCGCTACCGCACCGCATC
ATCACCTCCCGCGCCCCCGTTCGTGACCTCTGGCGCGTCCTCCACCCTCACAGCTCCCTCGGCCCGGCCCGCCAC
CCCGCCGAGGCCGCTCGCAACCGACCCGTGCCCGGCGCCCGCTTTAACCTGGAGGAGAACGGGGCGACGAGCGAT
GGCCTCTATAACACCTGGCGGTGGACCAAGAATGCCCAGAATAGGCTCCGCGCCGGCCGGACCCCTTGTCCCGTG
GACCCCGACGCCCCCGATGAGCGCGGGAAGCGGCTCGACTACATCTTTGCCTCGATCGGCTTGACCTCCCCCGAG
TCCGCCTCCTCCTCTCGCCGCCGCTGGGTCGTCAAGTCGGCCGCCGTCACCCTGACGGATCCGCATCCCGACCTC
GGCGTCTCCCTATCCGACCACTTCGCCGTCAGCGCCACTATCCGCCAGCATTCCGCTGCCGACGGCGACGACGAC
GACGACGACGACGACGAAAAAAGCCGGCTCGAAAACAACACTACCACCACCACCCTCCCCCTATCCGCCTACGAC
GAAATCCTCTCCCTCGTCGACGCCTACACCGCCCGAGAGCGCTCCCAGCGCCGCTACCGCGCCCTGCATTTCTAT
GCCGCCCTCGTCGTCTGGGCCGCGTGCCTCGTGGCCGTCTGGTTCGCCCCCGGTAACTTTGTCTGCTTCCTGCTC
GCCCTCGTCGGCAGCCTGGTCCTGGCCGCTGGTCTGATTGATGGCCTGCTCGCCCTGCTCTTCTTCTCGTCCGAG
CTGCGAAGCCTCGATGAATTCGCCTGGGAGGTTCGTAACGCGAGATGGGCCGCTGCTGCTTGTCCCGTGAAGCAG
AAG
Transcript >Ophio5|6370
ATGTCACGCAAAGACGCTGCAGCCGACGTGTCCTCCTCCATGCCGGACACGGAACCTCGCGACGACGACGACGAC
GACGACGACGACGGCCTCCTCCCCCCGTCTGAACTGACGCTCCTGACGCTCAACTGCTGGGGCCTCGAGCACATC
TCCTCCGTCCGGAGGCAAAGACTGGGCGAGGTGGGCCGGCGGCTGGCTCGGATGCGGCCACGGCCTCAGATCGTC
TGCCTGCAGGAGTGCTGGGTGGAGAGCGATTTCCAGGCCATACGGGAGGCTACCCGTCACCTGTTGCCTCACGCC
AAGATGTACCGCGCCGGCGTCTTCGGTGCCGGTCTCGTCATACTCAGTCGTTGGCCCTTTCAGGATTCCTCCATG
CTCATCTTTCCCCTCAATGGCCGCCCTACCGCTTTTTGGAGGGGCGATTGGTATGTCGGCAAGGGCGTCGCCTGC
GCTGTCTTGAGGGTTGGCCCGGCTGAGGGGGACGTCATTCACGTCTTTAACACGCATACTCATGCCCCTTACCAA
AAACACCATCGCGACGACTCATACGCCTGCCACCGCGTCGCACAAGCATGGGAGATATCCAAGCTCCTCCGGACC
GCCACGGCAACAGGCCGTCTCGTCGTCGCCCTCGGCGACTTCAACATGCTCCCTCTCTCGCTACCGCACCGCATC
ATCACCTCCCGCGCCCCCGTTCGTGACCTCTGGCGCGTCCTCCACCCTCACAGCTCCCTCGGCCCGGCCCGCCAC
CCCGCCGAGGCCGCTCGCAACCGACCCGTGCCCGGCGCCCGCTTTAACCTGGAGGAGAACGGGGCGACGAGCGAT
GGCCTCTATAACACCTGGCGGTGGACCAAGAATGCCCAGAATAGGCTCCGCGCCGGCCGGACCCCTTGTCCCGTG
GACCCCGACGCCCCCGATGAGCGCGGGAAGCGGCTCGACTACATCTTTGCCTCGATCGGCTTGACCTCCCCCGAG
TCCGCCTCCTCCTCTCGCCGCCGCTGGGTCGTCAAGTCGGCCGCCGTCACCCTGACGGATCCGCATCCCGACCTC
GGCGTCTCCCTATCCGACCACTTCGCCGTCAGCGCCACTATCCGCCAGCATTCCGCTGCCGACGGCGACGACGAC
GACGACGACGACGACGAAAAAAGCCGGCTCGAAAACAACACTACCACCACCACCCTCCCCCTATCCGCCTACGAC
GAAATCCTCTCCCTCGTCGACGCCTACACCGCCCGAGAGCGCTCCCAGCGCCGCTACCGCGCCCTGCATTTCTAT
GCCGCCCTCGTCGTCTGGGCCGCGTGCCTCGTGGCCGTCTGGTTCGCCCCCGGTAACTTTGTCTGCTTCCTGCTC
GCCCTCGTCGGCAGCCTGGTCCTGGCCGCTGGTCTGATTGATGGCCTGCTCGCCCTGCTCTTCTTCTCGTCCGAG
CTGCGAAGCCTCGATGAATTCGCCTGGGAGGTTCGTAACGCGAGATGGGCCGCTGCTGCTTGTCCCGTGAAGCAG
AAGTGA
Gene >Ophio5|6370
ATGTCACGCAAAGACGCTGCAGCCGACGTGTCCTCCTCCATGCCGGACACGGAACCTCGCGACGACGACGACGAC
GACGACGACGACGGCCTCCTCCCCCCGTCTGAACTGACGCTCCTGACGCTCAACTGCTGGGGCCTCGAGCACATC
TCCTCCGTCCGGAGGCAAAGACTGGGCGAGGTGGGCCGGCGGCTGGCTCGGATGCGGCCACGGCCTCAGATCGTC
TGCCTGCAGGAGTGCTGGGTGGAGAGCGATTTCCAGGCCATACGGGAGGCTACCCGTCACCTGTTGCCTCACGCC
AAGATGTACCGCGCCGGCGTCTTCGGTGCCGGTCTCGTCATACTCAGTCGTTGGCCCTTTCAGGATTCCTCCATG
CTCATCTTTCCCCTCAATGGCCGCCCTACCGCTTTTTGGAGGGGCGATTGGTATGTCGGCAAGGGCGTCGCCTGC
GCTGTCTTGAGGGTTGGCCCGGCTGAGGGGGACGTCATTCACGTCTTTAACACGCATGTGAGCCTACGACTCTCC
TCGCATGATATCGGCCAGCTTGTTGAATTCAAAACCCCCCCCCATCATTCAGACTCATGCCCCTTACCAAAAACA
CCATCGCGACGACTCATACGCCTGCCACCGCGTCGCACAAGCATGGGAGATATCCAAGCTCCTCCGGACCGCCAC
GGCAACAGGCCGTCTCGTCGTCGCCCTCGGCGACTTCAACATGCTCCCTCTCTCGCTACCGCACCGCATCATCAC
CTCCCGCGCCCCCGTTCGTGACCTCTGGCGCGTCCTCCACCCTCACAGCTCCCTCGGCCCGGCCCGCCACCCCGC
CGAGGCCGCTCGCAACCGACCCGTGCCCGGCGCCCGCTTTAACCTGGAGGAGAACGGGGCGACGAGCGATGGCCT
CTATAACACCTGGCGGTGGACCAAGAATGCCCAGAATAGGCTCCGCGCCGGCCGGACCCCTTGTCCCGTGGACCC
CGACGCCCCCGATGAGCGCGGGAAGCGGCTCGACTACATCTTTGCCTCGATCGGCTTGACCTCCCCCGAGTCCGC
CTCCTCCTCTCGCCGCCGCTGGGTCGTCAAGTCGGCCGCCGTCACCCTGACGGATCCGCATCCCGACCTCGGCGT
CTCCCTATCCGACCACTTCGCCGTCAGCGCCACTATCCGCCAGCATTCCGCTGCCGACGGCGACGACGACGACGA
CGACGACGACGAAAAAAGCCGGCTCGAAAACAACACTACCACCACCACCCTCCCCCTATCCGCCTACGACGAAAT
CCTCTCCCTCGTCGACGCCTACACCGCCCGAGAGCGCTCCCAGCGCCGCTACCGCGCCCTGCATTTCTATGCCGC
CCTCGTCGTCTGGGCCGCGTGCCTCGTGGCCGTCTGGTTCGCCCCCGGTAACTTTGTCTGCTTCCTGCTCGCCCT
CGTCGGCAGCCTGGTCCTGGCCGCTGGTCTGATTGATGGCCTGCTCGCCCTGCTCTTCTTCTCGTCCGAGCTGCG
AAGCCTCGATGAATTCGCCTGGGAGGTTCGTAACGCGAGATGGGCCGCTGCTGCTTGTCCCGTGAAGCAGAAGTG
A

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail