Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|6369
Gene name
Locationscaffold_553:11095..12883
Strand-
Gene length (bp)1788
Transcript length (bp)1788
Coding sequence length (bp)1785
Protein length (aa) 595

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF02733 Dak1 Dak1 domain 5.3E-104 19 344
PF02734 Dak2 DAK2 domain 1.4E-41 414 588

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O60017|DAK_PICAN Dihydroxyacetone kinase OS=Pichia angusta GN=DAK PE=3 SV=1 1 582 2.0E-138
sp|O74192|DAK_PICPA Dihydroxyacetone kinase OS=Komagataella pastoris GN=DAK PE=3 SV=1 1 595 4.0E-133
sp|O13902|DAK1_SCHPO Dihydroxyacetone kinase 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=dak1 PE=3 SV=1 4 587 4.0E-126
sp|P43550|DAK2_YEAST Dihydroxyacetone kinase 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DAK2 PE=3 SV=1 1 577 5.0E-122
sp|O74215|DAK2_SCHPO Dihydroxyacetone kinase 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=dak2 PE=3 SV=2 7 587 2.0E-120
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O60017|DAK_PICAN Dihydroxyacetone kinase OS=Pichia angusta GN=DAK PE=3 SV=1 1 582 2.0E-138
sp|O74192|DAK_PICPA Dihydroxyacetone kinase OS=Komagataella pastoris GN=DAK PE=3 SV=1 1 595 4.0E-133
sp|O13902|DAK1_SCHPO Dihydroxyacetone kinase 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=dak1 PE=3 SV=1 4 587 4.0E-126
sp|P43550|DAK2_YEAST Dihydroxyacetone kinase 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DAK2 PE=3 SV=1 1 577 5.0E-122
sp|O74215|DAK2_SCHPO Dihydroxyacetone kinase 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=dak2 PE=3 SV=2 7 587 2.0E-120
sp|P54838|DAK1_YEAST Dihydroxyacetone kinase 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DAK1 PE=1 SV=1 14 591 5.0E-115
sp|Q8VC30|TKFC_MOUSE Triokinase/FMN cyclase OS=Mus musculus GN=Tkfc PE=1 SV=1 1 592 2.0E-81
sp|Q3LXA3|TKFC_HUMAN Triokinase/FMN cyclase OS=Homo sapiens GN=TKFC PE=1 SV=2 1 576 6.0E-79
sp|Q58DK4|TKFC_BOVIN Triokinase/FMN cyclase OS=Bos taurus GN=TKFC PE=2 SV=1 1 576 3.0E-78
sp|Q4KLZ6|TKFC_RAT Triokinase/FMN cyclase OS=Rattus norvegicus GN=Tkfc PE=1 SV=1 1 592 8.0E-72
sp|F1RKQ4|TKFC_PIG Triokinase/FMN cyclase OS=Sus scrofa GN=TKFC PE=1 SV=2 1 522 6.0E-71
sp|O04059|DHBK_SOLLC Putative 3,4-dihydroxy-2-butanone kinase OS=Solanum lycopersicum GN=DHBK PE=2 SV=1 1 561 2.0E-65
sp|Q55EE0|DHAK_DICDI Probable dihydroxyacetone kinase OS=Dictyostelium discoideum GN=dhak PE=3 SV=1 39 589 5.0E-54
sp|P45510|DHAK_CITFR Dihydroxyacetone kinase OS=Citrobacter freundii GN=dhaK PE=1 SV=3 4 587 6.0E-51
sp|Q9CIW0|DHAQ_LACLA DhaKLM operon coactivator DhaQ OS=Lactococcus lactis subsp. lactis (strain IL1403) GN=dhaQ PE=1 SV=2 6 320 5.0E-45
sp|Q9CIV8|DHAK_LACLA PTS-dependent dihydroxyacetone kinase, dihydroxyacetone-binding subunit DhaK OS=Lactococcus lactis subsp. lactis (strain IL1403) GN=dhaK PE=1 SV=2 1 320 2.0E-42
sp|P76015|DHAK_ECOLI PTS-dependent dihydroxyacetone kinase, dihydroxyacetone-binding subunit DhaK OS=Escherichia coli (strain K12) GN=dhaK PE=1 SV=2 4 320 2.0E-39
sp|P45620|Y235_MYCCT Putative kinase MCAP_0235 OS=Mycoplasma capricolum subsp. capricolum (strain California kid / ATCC 27343 / NCTC 10154) GN=MCAP_0235 PE=3 SV=2 402 591 9.0E-10
[Show less]

GO

GO Term Description Terminal node
GO:0006071 glycerol metabolic process Yes
GO:0004371 glycerone kinase activity Yes
GO:0016740 transferase activity No
GO:0044281 small molecule metabolic process No
GO:0008150 biological_process No
GO:0044262 cellular carbohydrate metabolic process No
GO:0044238 primary metabolic process No
GO:0005975 carbohydrate metabolic process No
GO:0008152 metabolic process No
GO:0044237 cellular metabolic process No
GO:0003674 molecular_function No
GO:0003824 catalytic activity No
GO:0071704 organic substance metabolic process No
GO:0009987 cellular process No
GO:0006066 alcohol metabolic process No
GO:0019751 polyol metabolic process No
GO:0016773 phosphotransferase activity, alcohol group as acceptor No
GO:0016301 kinase activity No
GO:0016772 transferase activity, transferring phosphorus-containing groups No
GO:1901615 organic hydroxy compound metabolic process No
GO:0019400 alditol metabolic process No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm|Nucleus Peroxisomal targeting signal 0.6713 0.5836 0.0269 0.0173 0.6356 0.111 0.079 0.1523 0.1116 0.5157

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup693
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|5917
Ophiocordyceps australis map64 (Brazil) OphauB2|7259
Ophiocordyceps camponoti-floridani Ophcf2|00699
Ophiocordyceps camponoti-rufipedis Ophun1|4889
Ophiocordyceps kimflemingae Ophio5|6369 (this protein)
Ophiocordyceps subramaniannii Hirsu2|1197
Ophiocordyceps subramaniannii Hirsu2|2959

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|6369
MSKRHLFNSADGLVDKALRGIVSYNPSLSLDEANRVVFDGSHDEARVSLVSGGGSGHEPAWAGYVGSNMLAAAVQ
GDVFASPSTRQILAAVDAVPSREGTILVVTNYTGDCLHFGLATEKANARGRRCRILICGDDVSVGRRAGLVGRRG
LAGQIAVLKAMGAAAGSGASLDHVYDLGVAVSSQVVSMAATLDHCHVPGRTEHGALADDEVEIGTGPHNEPGYKK
LSPAPEPAELVRQLLRHCLDEADADRAYVRFAPGDETVVLVNNFGGMSQLEMGALVDEVLEQLSHDWKMEPVRVY
AGALETSLNAPAFSLSVINITAAAAARSCRYSVDDIKSFFDARTSTCWEAVAGSQVVCRPRRQQLVKPAPTAPKS
VDPDRHLRVDAIVLDRMLRAACVSLVETEPELTRWDTVMGDGDCGETLKTGATAMLAALDRGLAKSGSVCEVLLE
LEDVAESKMGGTLGGILGIFFVSLRSAVEDEVGRGSKASPEALWAAALSAALDSLHRYTPAKVGDRTVMDTLIPF
SEAINRSGFDDGVGAAVQGAEATKTMKPRLGRATYVGVGSDHGQEMPPDPGAWAAMVVIRALHSGLQGSE
Coding >Ophio5|6369
ATGTCGAAGCGTCACCTCTTCAACTCAGCCGATGGCCTCGTCGACAAGGCCCTGAGGGGCATCGTCTCGTACAAC
CCGTCGTTGAGCTTAGACGAGGCCAACCGCGTCGTCTTTGACGGCTCCCATGACGAGGCTCGTGTCAGCCTCGTC
AGTGGTGGCGGTTCCGGCCATGAGCCGGCTTGGGCGGGCTACGTCGGCTCCAATATGCTCGCGGCCGCCGTTCAG
GGCGACGTCTTTGCCAGCCCGAGCACGAGACAGATCCTGGCGGCCGTCGACGCCGTTCCCAGTCGAGAGGGCACC
ATTCTCGTCGTCACCAACTATACCGGCGACTGTCTTCACTTCGGCTTGGCTACGGAAAAGGCCAACGCTCGGGGC
CGCCGCTGTCGCATCCTCATCTGCGGCGACGACGTCTCAGTCGGTCGTCGCGCCGGCCTCGTTGGTCGCCGTGGA
CTGGCCGGCCAGATTGCCGTTCTCAAGGCCATGGGAGCGGCCGCCGGATCCGGAGCTTCACTGGATCATGTCTAT
GACTTGGGCGTCGCCGTCTCCAGTCAGGTCGTCTCCATGGCCGCCACACTGGACCACTGCCATGTCCCTGGACGG
ACCGAGCACGGAGCGTTGGCCGACGACGAGGTCGAGATCGGCACCGGCCCGCACAACGAGCCGGGCTACAAGAAG
CTGTCTCCCGCTCCTGAGCCGGCCGAGTTGGTCCGCCAACTACTCCGGCATTGTCTGGACGAGGCCGACGCCGAC
CGGGCCTACGTCCGCTTTGCCCCCGGCGACGAGACCGTTGTGCTCGTAAACAACTTTGGCGGCATGTCGCAGCTT
GAGATGGGCGCCCTCGTCGACGAGGTCCTCGAGCAGCTGAGCCATGACTGGAAAATGGAGCCCGTCCGCGTCTAC
GCCGGTGCCCTCGAGACGTCACTGAATGCCCCGGCCTTCTCCCTATCCGTCATCAACATCACCGCCGCCGCCGCG
GCCCGCAGTTGTCGCTACTCAGTCGACGATATCAAATCATTCTTCGACGCGAGGACAAGCACCTGCTGGGAAGCC
GTCGCCGGCTCACAGGTTGTCTGCCGTCCGCGTCGACAGCAGCTCGTCAAGCCGGCTCCCACGGCGCCCAAATCG
GTCGATCCCGACCGTCATCTCCGGGTGGATGCCATCGTTTTGGATCGCATGCTACGGGCCGCTTGCGTCAGCCTC
GTCGAGACGGAGCCCGAACTGACCCGGTGGGATACCGTCATGGGCGATGGTGACTGCGGCGAGACGCTCAAGACG
GGCGCTACCGCCATGCTCGCCGCGCTGGACCGGGGACTGGCCAAGTCCGGTTCTGTCTGCGAGGTGCTGCTAGAG
CTCGAGGACGTGGCCGAGAGCAAGATGGGCGGAACCCTCGGCGGCATCCTCGGCATCTTCTTCGTCTCGCTCCGG
TCCGCCGTCGAGGACGAGGTCGGTCGAGGGTCCAAGGCATCTCCTGAGGCACTGTGGGCAGCAGCCTTGTCAGCA
GCTCTCGACAGCCTTCATCGTTACACGCCGGCCAAGGTCGGAGACCGAACCGTAATGGACACGCTCATCCCCTTT
TCCGAGGCCATCAACCGCTCCGGCTTCGACGACGGCGTCGGCGCCGCCGTTCAGGGGGCCGAGGCCACCAAGACG
ATGAAGCCCAGACTGGGGAGGGCGACGTACGTCGGGGTAGGGTCGGATCATGGCCAGGAAATGCCCCCTGACCCG
GGCGCCTGGGCCGCCATGGTGGTCATCCGCGCGCTGCACAGCGGGCTTCAAGGATCCGAG
Transcript >Ophio5|6369
ATGTCGAAGCGTCACCTCTTCAACTCAGCCGATGGCCTCGTCGACAAGGCCCTGAGGGGCATCGTCTCGTACAAC
CCGTCGTTGAGCTTAGACGAGGCCAACCGCGTCGTCTTTGACGGCTCCCATGACGAGGCTCGTGTCAGCCTCGTC
AGTGGTGGCGGTTCCGGCCATGAGCCGGCTTGGGCGGGCTACGTCGGCTCCAATATGCTCGCGGCCGCCGTTCAG
GGCGACGTCTTTGCCAGCCCGAGCACGAGACAGATCCTGGCGGCCGTCGACGCCGTTCCCAGTCGAGAGGGCACC
ATTCTCGTCGTCACCAACTATACCGGCGACTGTCTTCACTTCGGCTTGGCTACGGAAAAGGCCAACGCTCGGGGC
CGCCGCTGTCGCATCCTCATCTGCGGCGACGACGTCTCAGTCGGTCGTCGCGCCGGCCTCGTTGGTCGCCGTGGA
CTGGCCGGCCAGATTGCCGTTCTCAAGGCCATGGGAGCGGCCGCCGGATCCGGAGCTTCACTGGATCATGTCTAT
GACTTGGGCGTCGCCGTCTCCAGTCAGGTCGTCTCCATGGCCGCCACACTGGACCACTGCCATGTCCCTGGACGG
ACCGAGCACGGAGCGTTGGCCGACGACGAGGTCGAGATCGGCACCGGCCCGCACAACGAGCCGGGCTACAAGAAG
CTGTCTCCCGCTCCTGAGCCGGCCGAGTTGGTCCGCCAACTACTCCGGCATTGTCTGGACGAGGCCGACGCCGAC
CGGGCCTACGTCCGCTTTGCCCCCGGCGACGAGACCGTTGTGCTCGTAAACAACTTTGGCGGCATGTCGCAGCTT
GAGATGGGCGCCCTCGTCGACGAGGTCCTCGAGCAGCTGAGCCATGACTGGAAAATGGAGCCCGTCCGCGTCTAC
GCCGGTGCCCTCGAGACGTCACTGAATGCCCCGGCCTTCTCCCTATCCGTCATCAACATCACCGCCGCCGCCGCG
GCCCGCAGTTGTCGCTACTCAGTCGACGATATCAAATCATTCTTCGACGCGAGGACAAGCACCTGCTGGGAAGCC
GTCGCCGGCTCACAGGTTGTCTGCCGTCCGCGTCGACAGCAGCTCGTCAAGCCGGCTCCCACGGCGCCCAAATCG
GTCGATCCCGACCGTCATCTCCGGGTGGATGCCATCGTTTTGGATCGCATGCTACGGGCCGCTTGCGTCAGCCTC
GTCGAGACGGAGCCCGAACTGACCCGGTGGGATACCGTCATGGGCGATGGTGACTGCGGCGAGACGCTCAAGACG
GGCGCTACCGCCATGCTCGCCGCGCTGGACCGGGGACTGGCCAAGTCCGGTTCTGTCTGCGAGGTGCTGCTAGAG
CTCGAGGACGTGGCCGAGAGCAAGATGGGCGGAACCCTCGGCGGCATCCTCGGCATCTTCTTCGTCTCGCTCCGG
TCCGCCGTCGAGGACGAGGTCGGTCGAGGGTCCAAGGCATCTCCTGAGGCACTGTGGGCAGCAGCCTTGTCAGCA
GCTCTCGACAGCCTTCATCGTTACACGCCGGCCAAGGTCGGAGACCGAACCGTAATGGACACGCTCATCCCCTTT
TCCGAGGCCATCAACCGCTCCGGCTTCGACGACGGCGTCGGCGCCGCCGTTCAGGGGGCCGAGGCCACCAAGACG
ATGAAGCCCAGACTGGGGAGGGCGACGTACGTCGGGGTAGGGTCGGATCATGGCCAGGAAATGCCCCCTGACCCG
GGCGCCTGGGCCGCCATGGTGGTCATCCGCGCGCTGCACAGCGGGCTTCAAGGATCCGAGTAG
Gene >Ophio5|6369
ATGTCGAAGCGTCACCTCTTCAACTCAGCCGATGGCCTCGTCGACAAGGCCCTGAGGGGCATCGTCTCGTACAAC
CCGTCGTTGAGCTTAGACGAGGCCAACCGCGTCGTCTTTGACGGCTCCCATGACGAGGCTCGTGTCAGCCTCGTC
AGTGGTGGCGGTTCCGGCCATGAGCCGGCTTGGGCGGGCTACGTCGGCTCCAATATGCTCGCGGCCGCCGTTCAG
GGCGACGTCTTTGCCAGCCCGAGCACGAGACAGATCCTGGCGGCCGTCGACGCCGTTCCCAGTCGAGAGGGCACC
ATTCTCGTCGTCACCAACTATACCGGCGACTGTCTTCACTTCGGCTTGGCTACGGAAAAGGCCAACGCTCGGGGC
CGCCGCTGTCGCATCCTCATCTGCGGCGACGACGTCTCAGTCGGTCGTCGCGCCGGCCTCGTTGGTCGCCGTGGA
CTGGCCGGCCAGATTGCCGTTCTCAAGGCCATGGGAGCGGCCGCCGGATCCGGAGCTTCACTGGATCATGTCTAT
GACTTGGGCGTCGCCGTCTCCAGTCAGGTCGTCTCCATGGCCGCCACACTGGACCACTGCCATGTCCCTGGACGG
ACCGAGCACGGAGCGTTGGCCGACGACGAGGTCGAGATCGGCACCGGCCCGCACAACGAGCCGGGCTACAAGAAG
CTGTCTCCCGCTCCTGAGCCGGCCGAGTTGGTCCGCCAACTACTCCGGCATTGTCTGGACGAGGCCGACGCCGAC
CGGGCCTACGTCCGCTTTGCCCCCGGCGACGAGACCGTTGTGCTCGTAAACAACTTTGGCGGCATGTCGCAGCTT
GAGATGGGCGCCCTCGTCGACGAGGTCCTCGAGCAGCTGAGCCATGACTGGAAAATGGAGCCCGTCCGCGTCTAC
GCCGGTGCCCTCGAGACGTCACTGAATGCCCCGGCCTTCTCCCTATCCGTCATCAACATCACCGCCGCCGCCGCG
GCCCGCAGTTGTCGCTACTCAGTCGACGATATCAAATCATTCTTCGACGCGAGGACAAGCACCTGCTGGGAAGCC
GTCGCCGGCTCACAGGTTGTCTGCCGTCCGCGTCGACAGCAGCTCGTCAAGCCGGCTCCCACGGCGCCCAAATCG
GTCGATCCCGACCGTCATCTCCGGGTGGATGCCATCGTTTTGGATCGCATGCTACGGGCCGCTTGCGTCAGCCTC
GTCGAGACGGAGCCCGAACTGACCCGGTGGGATACCGTCATGGGCGATGGTGACTGCGGCGAGACGCTCAAGACG
GGCGCTACCGCCATGCTCGCCGCGCTGGACCGGGGACTGGCCAAGTCCGGTTCTGTCTGCGAGGTGCTGCTAGAG
CTCGAGGACGTGGCCGAGAGCAAGATGGGCGGAACCCTCGGCGGCATCCTCGGCATCTTCTTCGTCTCGCTCCGG
TCCGCCGTCGAGGACGAGGTCGGTCGAGGGTCCAAGGCATCTCCTGAGGCACTGTGGGCAGCAGCCTTGTCAGCA
GCTCTCGACAGCCTTCATCGTTACACGCCGGCCAAGGTCGGAGACCGAACCGTAATGGACACGCTCATCCCCTTT
TCCGAGGCCATCAACCGCTCCGGCTTCGACGACGGCGTCGGCGCCGCCGTTCAGGGGGCCGAGGCCACCAAGACG
ATGAAGCCCAGACTGGGGAGGGCGACGTACGTCGGGGTAGGGTCGGATCATGGCCAGGAAATGCCCCCTGACCCG
GGCGCCTGGGCCGCCATGGTGGTCATCCGCGCGCTGCACAGCGGGCTTCAAGGATCCGAGTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail