Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|6366
Gene name
Locationscaffold_552:9408..10090
Strand+
Gene length (bp)682
Transcript length (bp)420
Coding sequence length (bp)417
Protein length (aa) 139

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

(None)

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Extracellular Signal peptide 0.4245 0.4109 0.5107 0.1145 0.3541 0.0784 0.334 0.2948 0.2395 0.1982

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup6473
Change Orthofinder run
Species Protein ID
Ophiocordyceps camponoti-rufipedis Ophun1|5810
Ophiocordyceps kimflemingae Ophio5|6366 (this protein)
Ophiocordyceps subramaniannii Hirsu2|10

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|6366
MYASTLDAEHAASVLIPMILYMHLFVRIQSVPVAGLPLSLCTELSNFPTLATTTVIKTIRGRFTATLIVHTAVRL
RTLGRPGDLLDRLRRLWLATTWISPWHGTLPPHVETSGTGMALTCPNAQINSASYSLVLSILTS
Coding >Ophio5|6366
ATGTACGCGTCCACTCTCGATGCGGAGCATGCGGCTTCCGTTTTGATCCCGATGATTCTTTATATGCATTTGTTT
GTCAGGATCCAGTCGGTGCCTGTGGCTGGTCTGCCACTTTCGCTATGTACGGAGCTTTCCAATTTCCCAACTCTA
GCTACTACGACGGTGATCAAGACTATCCGTGGGCGCTTTACCGCAACCCTTATTGTGCACACTGCCGTTCGTCTC
CGGACTCTGGGACGTCCTGGAGATCTATTGGATAGACTACGTCGGCTATGGCTTGCAACGACGTGGATAAGTCCT
TGGCATGGCACTCTGCCGCCTCACGTGGAGACGTCAGGAACAGGAATGGCCTTAACGTGCCCGAATGCTCAGATA
AACTCGGCTTCGTACTCGCTGGTCCTCAGTATACTGACGTCA
Transcript >Ophio5|6366
ATGTACGCGTCCACTCTCGATGCGGAGCATGCGGCTTCCGTTTTGATCCCGATGATTCTTTATATGCATTTGTTT
GTCAGGATCCAGTCGGTGCCTGTGGCTGGTCTGCCACTTTCGCTATGTACGGAGCTTTCCAATTTCCCAACTCTA
GCTACTACGACGGTGATCAAGACTATCCGTGGGCGCTTTACCGCAACCCTTATTGTGCACACTGCCGTTCGTCTC
CGGACTCTGGGACGTCCTGGAGATCTATTGGATAGACTACGTCGGCTATGGCTTGCAACGACGTGGATAAGTCCT
TGGCATGGCACTCTGCCGCCTCACGTGGAGACGTCAGGAACAGGAATGGCCTTAACGTGCCCGAATGCTCAGATA
AACTCGGCTTCGTACTCGCTGGTCCTCAGTATACTGACGTCATAG
Gene >Ophio5|6366
ATGTACGCGTCCACTCTCGATGCGGAGCATGCGGCTTCCGTTTTGATCCCGATGATTCTTTATATGCATGTGAGC
AAGCAGTCTCTCGAGCTCTGGACTGGCCTCCCTGACGTTGTCCAGTTGTTTGTCAGGATCCAGTCGGTGCCTGTG
GCTGGTCTGCCACTTTCGCTATGTACGGAGCTTTCCAATTTCCCAACTCTAGCTACTACGACGGTGATCAAGACT
ATCCGTGGGCGCTTTACCGCAACCCTTATTGTGCACACTGCCGTTCGTCTCCGGACTCTGGTACTGTCTATGCAT
CTTGTTTGATGCTGTTTCTCCGCTAACCTGACTTGAACGGGGAGGGACGTCCTGGAGATCTATTGGATAGACTAC
GTCGGCTATGGCTTGCAACGACGTGGATAAGTCCTTGGCATGGCACTCTGCCGCCTCACGTGGAGACGTATGTGG
GCTACAGGAGTGACAGATATGTTGGTGGGATCTTGGATCATCTGCCCCAAAGGACTGAGTGAATGATTCAAGAAG
AGCATATGGTCGAGTGACCGTGCTGTGGCTCTGATCAACACCACCGTAGATGCTGACGACCATCTCCAGGTCAGG
AACAGGAATGGCCTTAACGTGCCCGAATGCTCAGATAAACTCGGCTTCGTACTCGCTGGTCCTCAGTATACTGAC
GTCATAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail