Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|6359
Gene name
Locationscaffold_550:9982..12880
Strand+
Gene length (bp)2898
Transcript length (bp)2835
Coding sequence length (bp)2832
Protein length (aa) 944

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q06833|YP091_YEAST Uncharacterized PH domain-containing protein YPR091C OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YPR091C PE=1 SV=1 4 480 1.0E-71
sp|O94464|YBR6_SCHPO Uncharacterized protein C23G7.06c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC23G7.06c PE=1 SV=3 5 477 4.0E-54

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.5

Transmembrane Domains

Domain # Start End Length
1 7 29 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|6359
MGNSWTAILVAYLVGGITLIPLVVAVVVLYGYYTFPRRDDVNPFADDHDVDYHVPDESSPLLAAEPNKARPSRDA
EVAAGYFAVCREYTPMGINAKPIERSTPLGSTTVTSPSPSVYQTMYRSIFDRKPSPAQDSNGLSQRPKKAGNVFY
VVLRHGHLMLFDDDEQLEVRHVISLAHHDISIYSGGDATPEGELFIKRNALCLSRRPDASDLAPTSKPFYLFSEN
CSAKEDFYFAMLRNQEQTFGFDTSAPRPKNFDVKSIIALVQRLHASEDHVHTRWLNAVLGRLFLAVYKTRDLENF
IRDKITNKIARVKRPSFLTNITIQGIDTGEAAPYFTNLKLKDLTVEGECVVEADVRYTGNFRIQVGATVKIDLGA
RFKARQVNLVLAVVLRRVEGHVLFKIKAPPTNRLWTSFQTMPKMEMTIEPIVSSRQITYTVILRQIESRIKEVFA
ETLVQPFWDDVPFFRTEHKQWRGGIFEGDDAVENDEAAASPVDEPGCGALPADDGLEQSATVTEGENRPLDIKSQ
LPLAAGAVEERTGLFGRKLGSVRNGHNSSPASVAVSAVATATDNKPSSSAATSPLRSPVLLKNPSDPIVGTETAH
ADLFKPSSSPPDHATNYMAALRSRSQDATTMGSSSTPLISPTKSKTLTKLPSRSSMRSNKEAGEDRETKSDAGSV
RPPGRRDTASSAESSADASSAHSASSAAAQAGGLLTGRGLFLRRENSSTTMESSNGGETAKRGTLAAVTNAAVQA
RQWGWNAFQRQKDVRRDRANSKVDLSQPMGRGQPLPPPGVPLPGPADYSGRRAAPMRWAAPEQPAADRDKALETG
KEKMLEADKEKTPEADREQQEPVPAQTRRRALSREQAGDDEQSMLVVEAPEDASQPGTPLAEGKETSTARDVSPS
PPTGGRPLVALPAKDEDEEDEDDYSGWMEDDVLDEHVHVAGEDQ
Coding >Ophio5|6359
ATGGGCAATTCCTGGACCGCCATACTGGTCGCCTACTTGGTGGGAGGCATCACGCTGATTCCGCTCGTCGTTGCC
GTCGTCGTCCTTTACGGCTACTATACCTTTCCGCGTCGCGACGATGTCAACCCCTTCGCCGATGATCATGATGTC
GATTACCATGTCCCGGACGAGTCCTCGCCGCTTCTCGCCGCAGAGCCCAACAAGGCACGCCCCAGTCGAGACGCC
GAGGTGGCTGCCGGATACTTTGCCGTCTGTCGCGAATACACGCCCATGGGAATCAACGCGAAGCCCATTGAGCGC
TCGACGCCCCTTGGCTCCACCACGGTGACATCCCCGAGCCCCAGTGTCTACCAAACCATGTATAGGAGCATCTTC
GACCGCAAGCCGTCCCCGGCCCAGGACAGCAACGGCCTGAGCCAGCGGCCCAAGAAGGCCGGCAACGTCTTTTAT
GTCGTTCTCCGACACGGCCATCTCATGCTCTTCGACGACGACGAGCAGCTCGAAGTCCGCCATGTCATCTCGCTC
GCCCACCATGACATCTCTATCTACTCTGGCGGCGACGCCACACCCGAGGGCGAGCTGTTTATCAAGCGCAACGCC
CTGTGCTTGTCGCGCCGCCCCGACGCCTCGGACCTGGCCCCCACGTCGAAGCCCTTTTATCTCTTCTCCGAGAAC
TGCTCGGCCAAGGAAGACTTTTACTTTGCCATGCTCCGCAACCAGGAGCAGACGTTCGGCTTCGACACGTCGGCA
CCGAGGCCCAAGAACTTTGACGTCAAGAGCATCATCGCTCTCGTCCAGCGCCTGCACGCGTCCGAGGACCACGTT
CACACGCGCTGGCTCAACGCCGTGCTCGGCCGTCTCTTCTTGGCCGTCTACAAGACGCGCGATCTGGAGAACTTC
ATCCGCGACAAGATCACCAACAAGATCGCCCGCGTCAAGAGGCCTTCGTTCCTGACAAACATCACCATACAGGGC
ATCGACACGGGAGAGGCGGCGCCTTATTTCACCAATCTCAAACTCAAGGACCTGACGGTCGAGGGCGAGTGTGTC
GTCGAGGCCGACGTCAGGTATACGGGCAACTTTCGCATCCAGGTCGGCGCGACTGTCAAGATCGACCTGGGCGCC
CGCTTCAAAGCCCGTCAGGTGAATTTGGTGCTGGCCGTGGTCCTGAGGCGCGTCGAGGGCCACGTCCTTTTCAAA
ATCAAGGCGCCCCCGACCAACCGACTCTGGACGTCGTTCCAGACCATGCCCAAGATGGAGATGACGATTGAGCCC
ATCGTGAGCTCGCGCCAGATCACCTATACCGTCATCCTCCGTCAGATCGAGAGTCGCATCAAGGAGGTCTTTGCC
GAGACGCTGGTACAGCCGTTCTGGGACGACGTTCCCTTTTTCCGCACCGAGCACAAGCAGTGGAGGGGGGGCATC
TTTGAAGGCGATGACGCCGTCGAAAACGACGAAGCCGCCGCCTCCCCGGTCGATGAGCCGGGCTGCGGTGCCCTT
CCGGCCGACGACGGCTTGGAGCAGAGTGCCACCGTCACCGAGGGCGAGAACCGGCCCCTGGACATTAAGAGTCAG
CTGCCTCTGGCCGCGGGTGCGGTGGAAGAGAGGACGGGACTCTTTGGCAGGAAGCTGGGCAGCGTGAGGAACGGA
CACAATAGCAGCCCGGCCTCAGTCGCCGTCTCAGCCGTCGCCACCGCCACCGACAACAAGCCGTCGAGCAGCGCG
GCTACGAGTCCGCTGCGATCGCCTGTACTGCTCAAGAACCCGTCGGACCCAATCGTCGGCACCGAGACGGCGCAT
GCCGACCTCTTCAAGCCGTCGTCGTCGCCGCCTGACCACGCCACCAACTACATGGCAGCGCTGCGGTCTCGCTCT
CAAGACGCGACGACGATGGGCAGCAGCAGCACGCCCCTGATCTCGCCGACCAAGTCGAAGACGCTGACCAAGCTG
CCGAGTCGGTCGTCGATGAGGTCCAACAAGGAGGCGGGCGAGGATCGCGAGACGAAGAGCGACGCCGGCTCCGTG
CGGCCTCCCGGACGACGGGACACGGCCTCGTCTGCCGAGTCGAGCGCGGACGCTTCGAGCGCCCATTCGGCGTCG
TCGGCCGCGGCCCAGGCGGGGGGTCTGTTGACGGGACGGGGCCTGTTTCTGCGGCGCGAAAACTCAAGCACGACG
ATGGAGTCGTCCAACGGCGGCGAGACGGCCAAGAGGGGCACTCTGGCAGCGGTAACAAACGCGGCTGTACAGGCG
CGGCAATGGGGCTGGAATGCCTTCCAGCGGCAGAAGGATGTCCGACGCGACAGGGCGAACAGCAAGGTCGATCTC
AGCCAGCCCATGGGCCGGGGCCAGCCGCTGCCGCCGCCGGGGGTGCCTTTGCCGGGGCCGGCGGACTACTCGGGA
CGGCGGGCGGCGCCCATGCGTTGGGCTGCGCCGGAGCAGCCCGCGGCGGACAGGGACAAGGCTCTCGAGACGGGC
AAGGAGAAGATGCTCGAGGCGGACAAGGAGAAGACACCGGAAGCAGACAGAGAACAGCAGGAGCCAGTGCCAGCG
CAGACCAGGAGACGGGCCCTGAGCCGGGAGCAGGCGGGCGACGACGAGCAGAGCATGTTGGTCGTCGAGGCGCCT
GAGGACGCATCGCAGCCCGGGACGCCGCTGGCCGAGGGCAAGGAGACGTCGACGGCCCGAGACGTGTCGCCTTCG
CCGCCGACTGGGGGGCGGCCTCTGGTCGCTCTGCCGGCCAAGGACGAGGACGAGGAGGATGAAGACGATTACTCG
GGGTGGATGGAGGATGACGTCCTCGACGAGCATGTGCACGTCGCGGGCGAGGATCAA
Transcript >Ophio5|6359
ATGGGCAATTCCTGGACCGCCATACTGGTCGCCTACTTGGTGGGAGGCATCACGCTGATTCCGCTCGTCGTTGCC
GTCGTCGTCCTTTACGGCTACTATACCTTTCCGCGTCGCGACGATGTCAACCCCTTCGCCGATGATCATGATGTC
GATTACCATGTCCCGGACGAGTCCTCGCCGCTTCTCGCCGCAGAGCCCAACAAGGCACGCCCCAGTCGAGACGCC
GAGGTGGCTGCCGGATACTTTGCCGTCTGTCGCGAATACACGCCCATGGGAATCAACGCGAAGCCCATTGAGCGC
TCGACGCCCCTTGGCTCCACCACGGTGACATCCCCGAGCCCCAGTGTCTACCAAACCATGTATAGGAGCATCTTC
GACCGCAAGCCGTCCCCGGCCCAGGACAGCAACGGCCTGAGCCAGCGGCCCAAGAAGGCCGGCAACGTCTTTTAT
GTCGTTCTCCGACACGGCCATCTCATGCTCTTCGACGACGACGAGCAGCTCGAAGTCCGCCATGTCATCTCGCTC
GCCCACCATGACATCTCTATCTACTCTGGCGGCGACGCCACACCCGAGGGCGAGCTGTTTATCAAGCGCAACGCC
CTGTGCTTGTCGCGCCGCCCCGACGCCTCGGACCTGGCCCCCACGTCGAAGCCCTTTTATCTCTTCTCCGAGAAC
TGCTCGGCCAAGGAAGACTTTTACTTTGCCATGCTCCGCAACCAGGAGCAGACGTTCGGCTTCGACACGTCGGCA
CCGAGGCCCAAGAACTTTGACGTCAAGAGCATCATCGCTCTCGTCCAGCGCCTGCACGCGTCCGAGGACCACGTT
CACACGCGCTGGCTCAACGCCGTGCTCGGCCGTCTCTTCTTGGCCGTCTACAAGACGCGCGATCTGGAGAACTTC
ATCCGCGACAAGATCACCAACAAGATCGCCCGCGTCAAGAGGCCTTCGTTCCTGACAAACATCACCATACAGGGC
ATCGACACGGGAGAGGCGGCGCCTTATTTCACCAATCTCAAACTCAAGGACCTGACGGTCGAGGGCGAGTGTGTC
GTCGAGGCCGACGTCAGGTATACGGGCAACTTTCGCATCCAGGTCGGCGCGACTGTCAAGATCGACCTGGGCGCC
CGCTTCAAAGCCCGTCAGGTGAATTTGGTGCTGGCCGTGGTCCTGAGGCGCGTCGAGGGCCACGTCCTTTTCAAA
ATCAAGGCGCCCCCGACCAACCGACTCTGGACGTCGTTCCAGACCATGCCCAAGATGGAGATGACGATTGAGCCC
ATCGTGAGCTCGCGCCAGATCACCTATACCGTCATCCTCCGTCAGATCGAGAGTCGCATCAAGGAGGTCTTTGCC
GAGACGCTGGTACAGCCGTTCTGGGACGACGTTCCCTTTTTCCGCACCGAGCACAAGCAGTGGAGGGGGGGCATC
TTTGAAGGCGATGACGCCGTCGAAAACGACGAAGCCGCCGCCTCCCCGGTCGATGAGCCGGGCTGCGGTGCCCTT
CCGGCCGACGACGGCTTGGAGCAGAGTGCCACCGTCACCGAGGGCGAGAACCGGCCCCTGGACATTAAGAGTCAG
CTGCCTCTGGCCGCGGGTGCGGTGGAAGAGAGGACGGGACTCTTTGGCAGGAAGCTGGGCAGCGTGAGGAACGGA
CACAATAGCAGCCCGGCCTCAGTCGCCGTCTCAGCCGTCGCCACCGCCACCGACAACAAGCCGTCGAGCAGCGCG
GCTACGAGTCCGCTGCGATCGCCTGTACTGCTCAAGAACCCGTCGGACCCAATCGTCGGCACCGAGACGGCGCAT
GCCGACCTCTTCAAGCCGTCGTCGTCGCCGCCTGACCACGCCACCAACTACATGGCAGCGCTGCGGTCTCGCTCT
CAAGACGCGACGACGATGGGCAGCAGCAGCACGCCCCTGATCTCGCCGACCAAGTCGAAGACGCTGACCAAGCTG
CCGAGTCGGTCGTCGATGAGGTCCAACAAGGAGGCGGGCGAGGATCGCGAGACGAAGAGCGACGCCGGCTCCGTG
CGGCCTCCCGGACGACGGGACACGGCCTCGTCTGCCGAGTCGAGCGCGGACGCTTCGAGCGCCCATTCGGCGTCG
TCGGCCGCGGCCCAGGCGGGGGGTCTGTTGACGGGACGGGGCCTGTTTCTGCGGCGCGAAAACTCAAGCACGACG
ATGGAGTCGTCCAACGGCGGCGAGACGGCCAAGAGGGGCACTCTGGCAGCGGTAACAAACGCGGCTGTACAGGCG
CGGCAATGGGGCTGGAATGCCTTCCAGCGGCAGAAGGATGTCCGACGCGACAGGGCGAACAGCAAGGTCGATCTC
AGCCAGCCCATGGGCCGGGGCCAGCCGCTGCCGCCGCCGGGGGTGCCTTTGCCGGGGCCGGCGGACTACTCGGGA
CGGCGGGCGGCGCCCATGCGTTGGGCTGCGCCGGAGCAGCCCGCGGCGGACAGGGACAAGGCTCTCGAGACGGGC
AAGGAGAAGATGCTCGAGGCGGACAAGGAGAAGACACCGGAAGCAGACAGAGAACAGCAGGAGCCAGTGCCAGCG
CAGACCAGGAGACGGGCCCTGAGCCGGGAGCAGGCGGGCGACGACGAGCAGAGCATGTTGGTCGTCGAGGCGCCT
GAGGACGCATCGCAGCCCGGGACGCCGCTGGCCGAGGGCAAGGAGACGTCGACGGCCCGAGACGTGTCGCCTTCG
CCGCCGACTGGGGGGCGGCCTCTGGTCGCTCTGCCGGCCAAGGACGAGGACGAGGAGGATGAAGACGATTACTCG
GGGTGGATGGAGGATGACGTCCTCGACGAGCATGTGCACGTCGCGGGCGAGGATCAATGA
Gene >Ophio5|6359
ATGGGCAATTCCTGGACCGCCATACTGGTCGCCTACTTGGTGGGAGGCATCACGCTGATTCCGCTCGTCGTTGCC
GTCGTCGTCCTTTACGGCTACTATACCTTTCCGCGTCGCGACGATGTCAACCCCTTCGCCGATGATCATGATGTC
GATTACCATGTCCCGGACGAGTCCTCGCCGCTTCTCGCCGCAGAGCCCAACAAGGCACGCCCCAGTCGAGACGCC
GAGGTGGCTGCCGGATACTTTGCCGTCTGTCGCGAATACACGCCCATGGGAATCAACGCGAAGCCCATTGAGCGC
TCGACGCCCCTTGGCTCCACCACGGTGACATCCCCGAGCCCCAGTGTCTACCAAACCATGTATAGGAGCATCTTC
GACCGCAAGCCGTCCCCGGCCCAGGACAGCAACGGCCTGAGCCAGCGGCCCAAGAAGGCCGGCAACGTCTTTTAT
GTCGTTCTCCGGTGCGTCAGAGTCCCCATCCCCTTACTTCCCACATATGACCCGCTGACCGCTATACTCTTCAGA
CACGGCCATCTCATGCTCTTCGACGACGACGAGCAGCTCGAAGTCCGCCATGTCATCTCGCTCGCCCACCATGAC
ATCTCTATCTACTCTGGCGGCGACGCCACACCCGAGGGCGAGCTGTTTATCAAGCGCAACGCCCTGTGCTTGTCG
CGCCGCCCCGACGCCTCGGACCTGGCCCCCACGTCGAAGCCCTTTTATCTCTTCTCCGAGAACTGCTCGGCCAAG
GAAGACTTTTACTTTGCCATGCTCCGCAACCAGGAGCAGACGTTCGGCTTCGACACGTCGGCACCGAGGCCCAAG
AACTTTGACGTCAAGAGCATCATCGCTCTCGTCCAGCGCCTGCACGCGTCCGAGGACCACGTTCACACGCGCTGG
CTCAACGCCGTGCTCGGCCGTCTCTTCTTGGCCGTCTACAAGACGCGCGATCTGGAGAACTTCATCCGCGACAAG
ATCACCAACAAGATCGCCCGCGTCAAGAGGCCTTCGTTCCTGACAAACATCACCATACAGGGCATCGACACGGGA
GAGGCGGCGCCTTATTTCACCAATCTCAAACTCAAGGACCTGACGGTCGAGGGCGAGTGTGTCGTCGAGGCCGAC
GTCAGGTATACGGGCAACTTTCGCATCCAGGTCGGCGCGACTGTCAAGATCGACCTGGGCGCCCGCTTCAAAGCC
CGTCAGGTGAATTTGGTGCTGGCCGTGGTCCTGAGGCGCGTCGAGGGCCACGTCCTTTTCAAAATCAAGGCGCCC
CCGACCAACCGACTCTGGACGTCGTTCCAGACCATGCCCAAGATGGAGATGACGATTGAGCCCATCGTGAGCTCG
CGCCAGATCACCTATACCGTCATCCTCCGTCAGATCGAGAGTCGCATCAAGGAGGTCTTTGCCGAGACGCTGGTA
CAGCCGTTCTGGGACGACGTTCCCTTTTTCCGCACCGAGCACAAGCAGTGGAGGGGGGGCATCTTTGAAGGCGAT
GACGCCGTCGAAAACGACGAAGCCGCCGCCTCCCCGGTCGATGAGCCGGGCTGCGGTGCCCTTCCGGCCGACGAC
GGCTTGGAGCAGAGTGCCACCGTCACCGAGGGCGAGAACCGGCCCCTGGACATTAAGAGTCAGCTGCCTCTGGCC
GCGGGTGCGGTGGAAGAGAGGACGGGACTCTTTGGCAGGAAGCTGGGCAGCGTGAGGAACGGACACAATAGCAGC
CCGGCCTCAGTCGCCGTCTCAGCCGTCGCCACCGCCACCGACAACAAGCCGTCGAGCAGCGCGGCTACGAGTCCG
CTGCGATCGCCTGTACTGCTCAAGAACCCGTCGGACCCAATCGTCGGCACCGAGACGGCGCATGCCGACCTCTTC
AAGCCGTCGTCGTCGCCGCCTGACCACGCCACCAACTACATGGCAGCGCTGCGGTCTCGCTCTCAAGACGCGACG
ACGATGGGCAGCAGCAGCACGCCCCTGATCTCGCCGACCAAGTCGAAGACGCTGACCAAGCTGCCGAGTCGGTCG
TCGATGAGGTCCAACAAGGAGGCGGGCGAGGATCGCGAGACGAAGAGCGACGCCGGCTCCGTGCGGCCTCCCGGA
CGACGGGACACGGCCTCGTCTGCCGAGTCGAGCGCGGACGCTTCGAGCGCCCATTCGGCGTCGTCGGCCGCGGCC
CAGGCGGGGGGTCTGTTGACGGGACGGGGCCTGTTTCTGCGGCGCGAAAACTCAAGCACGACGATGGAGTCGTCC
AACGGCGGCGAGACGGCCAAGAGGGGCACTCTGGCAGCGGTAACAAACGCGGCTGTACAGGCGCGGCAATGGGGC
TGGAATGCCTTCCAGCGGCAGAAGGATGTCCGACGCGACAGGGCGAACAGCAAGGTCGATCTCAGCCAGCCCATG
GGCCGGGGCCAGCCGCTGCCGCCGCCGGGGGTGCCTTTGCCGGGGCCGGCGGACTACTCGGGACGGCGGGCGGCG
CCCATGCGTTGGGCTGCGCCGGAGCAGCCCGCGGCGGACAGGGACAAGGCTCTCGAGACGGGCAAGGAGAAGATG
CTCGAGGCGGACAAGGAGAAGACACCGGAAGCAGACAGAGAACAGCAGGAGCCAGTGCCAGCGCAGACCAGGAGA
CGGGCCCTGAGCCGGGAGCAGGCGGGCGACGACGAGCAGAGCATGTTGGTCGTCGAGGCGCCTGAGGACGCATCG
CAGCCCGGGACGCCGCTGGCCGAGGGCAAGGAGACGTCGACGGCCCGAGACGTGTCGCCTTCGCCGCCGACTGGG
GGGCGGCCTCTGGTCGCTCTGCCGGCCAAGGACGAGGACGAGGAGGATGAAGACGATTACTCGGGGTGGATGGAG
GATGACGTCCTCGACGAGCATGTGCACGTCGCGGGCGAGGATCAATGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail