Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|6347
Gene name
Locationscaffold_55:31881..34200
Strand+
Gene length (bp)2319
Transcript length (bp)2175
Coding sequence length (bp)2172
Protein length (aa) 724

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF08590 DUF1771 Domain of unknown function (DUF1771) 8.0E-15 521 584
PF14608 zf-CCCH_2 RNA-binding, Nab2-type zinc finger 2.9E-02 286 304
PF14608 zf-CCCH_2 RNA-binding, Nab2-type zinc finger 3.5E-03 310 329
PF01713 Smr Smr domain 1.5E-06 596 651

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|O64843|CID7_ARATH Polyadenylate-binding protein-interacting protein 7 OS=Arabidopsis thaliana GN=CID7 PE=1 SV=1 485 651 1.0E-17
sp|Q86UW6|N4BP2_HUMAN NEDD4-binding protein 2 OS=Homo sapiens GN=N4BP2 PE=1 SV=2 521 663 3.0E-08
sp|Q6ZPZ3|ZC3H4_MOUSE Zinc finger CCCH domain-containing protein 4 OS=Mus musculus GN=Zc3h4 PE=1 SV=2 281 363 2.0E-07
sp|Q9UPT8|ZC3H4_HUMAN Zinc finger CCCH domain-containing protein 4 OS=Homo sapiens GN=ZC3H4 PE=1 SV=3 281 363 2.0E-07

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 66 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|6347
MVSDEHYELCLPILQDPSFEDEDRTDRLEELLKKETNLSGSALENVVLDAMWRYREASGASASPPPIRQSILRRP
SPASWRGSPTPLNGSPRLGVSPLAPPGFVSTFTRTKSSTASPFSSPRASPRLALATPAIPHSPNLNAYEFASDST
PAAEINGDYQTENVEWLVNDDAASVSSSVGTSSGLNAAAPEFSSMSSQQADMSPYDMLRSILGQTRTDDEIEASL
ATHGYDLSATITSIMESQARGGGLMAVPPIDEPKGVLIGKSISAEGRPTTPAGQQKTTIVCKFYLSTGQCLRADC
RFSHDLSNHLCKYWVMGSCLAGDTCIFSHDPSTLLNKVALEENGSDSARNQESPALQDVNSFPCLQEDKSGQKGD
GAGANAVGLPTPSGPRHLYGTEAPRLRSRPVSRQQAKETTTSAPAPDDNEAFPSLGSASARQGKKHHGKRGGHGH
GHKENLAPSSLADIVRRTPSPAPGPTRPESRKGVQNGNGRHGGENSAAAQAISSPKHIPWLETGERANKAYLKAR
QEAIKHGGLRNKFLQSAAQAWNRNDARAAKALSLRGQSENDLMRKAHREAARELYEQRNKGGINGGSEIYVDLHG
LHPDEAVDYLERTLLENSRETRPVYAITGTGHHSKSGKDKVGRAIRSYLGEWRYAYREFSVPGDRNSMGGILGVD
ARSWDKSLTREKGGQEGSKVDILSQGVEIGDGKVRLLVRDPPKGPSGRR
Coding >Ophio5|6347
ATGGTGTCCGACGAGCACTACGAGCTGTGCCTGCCCATCCTGCAGGACCCTTCGTTCGAAGACGAGGATAGGACG
GACAGGCTCGAGGAGCTACTCAAGAAAGAGACGAACCTGTCTGGCTCCGCGCTCGAGAACGTCGTTCTCGATGCC
ATGTGGAGGTATCGCGAGGCGAGTGGAGCGTCGGCATCGCCTCCGCCAATCCGCCAGTCCATCTTGCGCCGTCCT
TCTCCGGCATCCTGGCGCGGATCACCGACGCCCTTGAACGGATCCCCGCGGCTGGGCGTGAGCCCTCTGGCTCCT
CCCGGCTTCGTGTCCACCTTTACACGAACGAAGTCGTCGACGGCCTCTCCTTTCTCGTCGCCCCGTGCCTCCCCG
CGCCTCGCCCTGGCGACACCGGCCATACCGCACAGTCCGAACCTCAACGCCTACGAGTTTGCTAGCGACTCTACC
CCCGCAGCCGAGATCAATGGCGATTATCAGACGGAGAATGTCGAATGGCTCGTCAACGACGATGCTGCTAGCGTT
TCGTCGTCGGTCGGCACGTCGAGCGGGCTGAACGCCGCCGCACCCGAGTTCTCCTCCATGTCCTCGCAGCAGGCC
GACATGTCTCCTTACGACATGCTCCGCTCCATCCTTGGACAAACCCGGACGGATGATGAGATTGAGGCCTCACTC
GCCACACACGGCTACGACCTGAGCGCCACCATCACGTCCATAATGGAGAGCCAGGCCCGTGGAGGAGGGCTTATG
GCCGTACCTCCGATCGACGAGCCAAAGGGTGTGCTAATAGGAAAGTCCATCTCTGCTGAAGGACGCCCCACGACA
CCCGCGGGCCAGCAGAAGACGACAATCGTCTGCAAGTTTTACCTATCCACGGGCCAGTGTCTCCGCGCCGACTGC
CGCTTCAGTCACGATCTGAGCAACCATCTCTGCAAGTACTGGGTTATGGGAAGTTGTCTCGCCGGCGATACATGC
ATATTCTCTCACGATCCCTCGACGCTACTGAACAAGGTGGCCCTCGAAGAGAACGGAAGCGACTCGGCCAGGAAT
CAGGAAAGCCCTGCATTGCAGGATGTCAACTCGTTCCCTTGCTTACAGGAAGACAAATCGGGACAAAAGGGCGAC
GGCGCCGGCGCCAACGCGGTGGGCTTGCCTACCCCGTCGGGGCCGCGTCACCTCTACGGCACCGAGGCTCCGCGG
CTGAGATCGCGACCTGTCAGCCGACAGCAAGCCAAGGAGACGACGACGTCGGCCCCGGCTCCGGACGACAATGAG
GCATTCCCATCGCTGGGGTCGGCCTCGGCGAGGCAAGGCAAGAAGCACCACGGAAAGCGCGGCGGCCACGGTCAT
GGGCACAAGGAGAACCTGGCACCCAGCTCGCTGGCAGACATTGTCCGAAGGACGCCCTCGCCGGCGCCTGGGCCG
ACGCGGCCCGAATCGAGAAAGGGGGTTCAGAACGGCAACGGGCGCCACGGCGGCGAGAACAGCGCGGCGGCGCAG
GCCATCTCCAGCCCCAAGCACATTCCGTGGCTGGAGACGGGCGAGCGGGCGAACAAGGCGTACCTAAAGGCCCGT
CAAGAAGCCATTAAGCATGGCGGGCTTCGCAACAAGTTTTTGCAAAGCGCGGCGCAGGCGTGGAACCGCAACGAC
GCGAGGGCGGCCAAGGCGCTGAGCCTCCGCGGGCAGAGCGAGAACGACTTGATGCGGAAGGCGCACCGAGAGGCG
GCGCGCGAGCTGTACGAGCAACGGAACAAGGGCGGCATCAACGGCGGGTCGGAGATCTACGTCGACCTCCACGGA
CTGCATCCGGACGAGGCGGTGGATTACCTGGAGAGGACGCTGCTGGAGAACAGCAGGGAGACGCGCCCCGTCTAC
GCCATCACCGGCACAGGCCATCACAGCAAGAGCGGTAAGGACAAGGTGGGCAGGGCGATCCGCAGCTATCTCGGC
GAGTGGCGATACGCATACCGCGAGTTCTCGGTGCCGGGCGATCGCAACAGCATGGGCGGGATCCTGGGCGTCGAC
GCGCGCAGCTGGGACAAGTCGTTGACGCGGGAAAAGGGAGGTCAAGAGGGATCCAAGGTGGACATACTCAGCCAG
GGCGTGGAGATTGGGGACGGCAAGGTGAGGCTGCTGGTGCGGGATCCTCCCAAGGGACCGAGCGGGCGACGA
Transcript >Ophio5|6347
ATGGTGTCCGACGAGCACTACGAGCTGTGCCTGCCCATCCTGCAGGACCCTTCGTTCGAAGACGAGGATAGGACG
GACAGGCTCGAGGAGCTACTCAAGAAAGAGACGAACCTGTCTGGCTCCGCGCTCGAGAACGTCGTTCTCGATGCC
ATGTGGAGGTATCGCGAGGCGAGTGGAGCGTCGGCATCGCCTCCGCCAATCCGCCAGTCCATCTTGCGCCGTCCT
TCTCCGGCATCCTGGCGCGGATCACCGACGCCCTTGAACGGATCCCCGCGGCTGGGCGTGAGCCCTCTGGCTCCT
CCCGGCTTCGTGTCCACCTTTACACGAACGAAGTCGTCGACGGCCTCTCCTTTCTCGTCGCCCCGTGCCTCCCCG
CGCCTCGCCCTGGCGACACCGGCCATACCGCACAGTCCGAACCTCAACGCCTACGAGTTTGCTAGCGACTCTACC
CCCGCAGCCGAGATCAATGGCGATTATCAGACGGAGAATGTCGAATGGCTCGTCAACGACGATGCTGCTAGCGTT
TCGTCGTCGGTCGGCACGTCGAGCGGGCTGAACGCCGCCGCACCCGAGTTCTCCTCCATGTCCTCGCAGCAGGCC
GACATGTCTCCTTACGACATGCTCCGCTCCATCCTTGGACAAACCCGGACGGATGATGAGATTGAGGCCTCACTC
GCCACACACGGCTACGACCTGAGCGCCACCATCACGTCCATAATGGAGAGCCAGGCCCGTGGAGGAGGGCTTATG
GCCGTACCTCCGATCGACGAGCCAAAGGGTGTGCTAATAGGAAAGTCCATCTCTGCTGAAGGACGCCCCACGACA
CCCGCGGGCCAGCAGAAGACGACAATCGTCTGCAAGTTTTACCTATCCACGGGCCAGTGTCTCCGCGCCGACTGC
CGCTTCAGTCACGATCTGAGCAACCATCTCTGCAAGTACTGGGTTATGGGAAGTTGTCTCGCCGGCGATACATGC
ATATTCTCTCACGATCCCTCGACGCTACTGAACAAGGTGGCCCTCGAAGAGAACGGAAGCGACTCGGCCAGGAAT
CAGGAAAGCCCTGCATTGCAGGATGTCAACTCGTTCCCTTGCTTACAGGAAGACAAATCGGGACAAAAGGGCGAC
GGCGCCGGCGCCAACGCGGTGGGCTTGCCTACCCCGTCGGGGCCGCGTCACCTCTACGGCACCGAGGCTCCGCGG
CTGAGATCGCGACCTGTCAGCCGACAGCAAGCCAAGGAGACGACGACGTCGGCCCCGGCTCCGGACGACAATGAG
GCATTCCCATCGCTGGGGTCGGCCTCGGCGAGGCAAGGCAAGAAGCACCACGGAAAGCGCGGCGGCCACGGTCAT
GGGCACAAGGAGAACCTGGCACCCAGCTCGCTGGCAGACATTGTCCGAAGGACGCCCTCGCCGGCGCCTGGGCCG
ACGCGGCCCGAATCGAGAAAGGGGGTTCAGAACGGCAACGGGCGCCACGGCGGCGAGAACAGCGCGGCGGCGCAG
GCCATCTCCAGCCCCAAGCACATTCCGTGGCTGGAGACGGGCGAGCGGGCGAACAAGGCGTACCTAAAGGCCCGT
CAAGAAGCCATTAAGCATGGCGGGCTTCGCAACAAGTTTTTGCAAAGCGCGGCGCAGGCGTGGAACCGCAACGAC
GCGAGGGCGGCCAAGGCGCTGAGCCTCCGCGGGCAGAGCGAGAACGACTTGATGCGGAAGGCGCACCGAGAGGCG
GCGCGCGAGCTGTACGAGCAACGGAACAAGGGCGGCATCAACGGCGGGTCGGAGATCTACGTCGACCTCCACGGA
CTGCATCCGGACGAGGCGGTGGATTACCTGGAGAGGACGCTGCTGGAGAACAGCAGGGAGACGCGCCCCGTCTAC
GCCATCACCGGCACAGGCCATCACAGCAAGAGCGGTAAGGACAAGGTGGGCAGGGCGATCCGCAGCTATCTCGGC
GAGTGGCGATACGCATACCGCGAGTTCTCGGTGCCGGGCGATCGCAACAGCATGGGCGGGATCCTGGGCGTCGAC
GCGCGCAGCTGGGACAAGTCGTTGACGCGGGAAAAGGGAGGTCAAGAGGGATCCAAGGTGGACATACTCAGCCAG
GGCGTGGAGATTGGGGACGGCAAGGTGAGGCTGCTGGTGCGGGATCCTCCCAAGGGACCGAGCGGGCGACGATGA
Gene >Ophio5|6347
ATGGTGTCCGACGAGCACTACGAGCTGTGCCTGCCCATCCTGCAGGACCCTTCGTTCGAAGACGAGGATAGGACG
GACAGGCTCGAGGAGCTACTCAAGAAAGAGACGAACCTGTCTGGCTCCGCGCTCGAGAACGTCGTTCTCGATGCC
ATGTGGAGGTATCGCGAGGCGAGTGGAGCGTCGGCATCGCCTCCGCCAATCCGCCAGTCCATCTTGCGCCGTCCT
TCTCCGGCATCCTGGCGCGGATCACCGACGCCCTTGAACGGATCCCCGCGGCTGGGCGTGAGCCCTCTGGCTCCT
CCCGGCTTCGTGTCCACCTTTACACGAACGAAGTCGTCGACGGCCTCTCCTTTCTCGTCGCCCCGTGCCTCCCCG
CGCCTCGCCCTGGCGACACCGGCCATACCGCACAGTCCGAACCTCAACGCCTACGAGTTTGCTAGCGACTCTACC
CCCGCAGCCGAGATCAATGGCGATTATCAGACGGAGAATGTCGAATGGCTCGTCAACGACGATGCTGCTAGCGTT
TCGTCGTCGGTCGGCACGTCGAGCGGGCTGAACGCCGCCGCACCCGAGTTCTCCTCCATGTCCTCGCAGCAGGCC
GACATGTCTCCTTACGACATGCTCCGCTCCATCCTTGGACAAACCCGGACGGATGATGAGATTGAGGCCTCACTC
GCCACACACGGCTACGACCTGAGCGCCACCATCACGTCCATAATGGAGAGCCAGGCCCGTGGAGGAGGGCTTATG
GCCGTACCTCCGATCGACGAGCCAAAGGGTGTGCTAATAGGAAAGTCCATCTCTGCTGAAGGACGCCCCACGACA
CCCGCGGGCCAGCAGAAGACGACAATCGTCTGCAAGTTTTACCTATCCACGGGCCAGTGTCTCCGCGCCGACTGC
CGCTTCAGTCACGATCTGAGCAACCATCTCTGCAAGTGGGTCGCCCAATGCTTTCCCTTCGCTCACCACCTCGAT
AGCTGCCTCCAGACAAGCAGAGCTGACACTTTTCCTCGTCAGGTACTGGGTTATGGGAAGTTGTCTCGCCGGCGA
TACATGCATATTCTCTCACGATCCCTCGACGCTACTGAACAAGGTGGCCCTCGAAGAGAACGGAAGCGACTCGGC
CAGGAATCAGGAAAGCCCTGCATTGCAGGATGTCAACTCGTTCCCTTGCTTACAGGAAGACAAATCGGGACAAAA
GGGCGACGGCGCCGGCGCCAACGCGGTGGGCTTGCCTACCCCGTCGGGGCCGCGTCACCTCTACGGCACCGAGGC
TCCGCGGCTGAGATCGCGACCTGTCAGCCGACAGCAAGCCAAGGAGACGACGACGTCGGCCCCGGCTCCGGACGA
CAATGAGGCATTCCCATCGCTGGGGTCGGCCTCGGCGAGGCAAGGCAAGAAGCACCACGGAAAGCGCGGCGGCCA
CGGTCATGGGCACAAGGAGAACCTGGCACCCAGCTCGCTGGCAGACATTGTCCGAAGGACGCCCTCGCCGGCGCC
TGGGCCGACGCGGCCCGAATCGAGAAAGGGGGTTCAGAACGGCAACGGGCGCCACGGCGGCGAGAACAGCGCGGC
GGCGCAGGCCATCTCCAGCCCCAAGCACATTCCGTGGCTGGAGACGGGCGAGCGGGCGAACAAGGCGTACCTAAA
GGCCCGTCAAGAAGCCATTAAGCATGGCGGGCTTCGCAACAAGTTTTTGCAAAGGTAGGTCTACGGGGCATCCCC
GGGCGAGCATGCGATGGGCACGGGCTGACCGGGAACGATAGCGCGGCGCAGGCGTGGAACCGCAACGACGCGAGG
GCGGCCAAGGCGCTGAGCCTCCGCGGGCAGAGCGAGAACGACTTGATGCGGAAGGCGCACCGAGAGGCGGCGCGC
GAGCTGTACGAGCAACGGAACAAGGGCGGCATCAACGGCGGGTCGGAGATCTACGTCGACCTCCACGGACTGCAT
CCGGACGAGGCGGTGGATTACCTGGAGAGGACGCTGCTGGAGAACAGCAGGGAGACGCGCCCCGTCTACGCCATC
ACCGGCACAGGCCATCACAGCAAGAGCGGTAAGGACAAGGTGGGCAGGGCGATCCGCAGCTATCTCGGCGAGTGG
CGATACGCATACCGCGAGTTCTCGGTGCCGGGCGATCGCAACAGCATGGGCGGGATCCTGGGCGTCGACGCGCGC
AGCTGGGACAAGTCGTTGACGCGGGAAAAGGGAGGTCAAGAGGGATCCAAGGTGGACATACTCAGCCAGGGCGTG
GAGATTGGGGACGGCAAGGTGAGGCTGCTGGTGCGGGATCCTCCCAAGGGACCGAGCGGGCGACGATGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail