Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|6347
Gene name
Locationscaffold_55:31881..34200
Strand+
Gene length (bp)2319
Transcript length (bp)2175
Coding sequence length (bp)2172
Protein length (aa) 724

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF08590 DUF1771 Domain of unknown function (DUF1771) 8.0E-15 521 584
PF14608 zf-CCCH_2 RNA-binding, Nab2-type zinc finger 2.9E-02 286 304
PF14608 zf-CCCH_2 RNA-binding, Nab2-type zinc finger 3.5E-03 310 329
PF01713 Smr Smr domain 1.5E-06 596 651

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|O64843|CID7_ARATH Polyadenylate-binding protein-interacting protein 7 OS=Arabidopsis thaliana GN=CID7 PE=1 SV=1 485 651 1.0E-17
sp|Q86UW6|N4BP2_HUMAN NEDD4-binding protein 2 OS=Homo sapiens GN=N4BP2 PE=1 SV=2 521 663 3.0E-08
sp|Q6ZPZ3|ZC3H4_MOUSE Zinc finger CCCH domain-containing protein 4 OS=Mus musculus GN=Zc3h4 PE=1 SV=2 281 363 2.0E-07
sp|Q9UPT8|ZC3H4_HUMAN Zinc finger CCCH domain-containing protein 4 OS=Homo sapiens GN=ZC3H4 PE=1 SV=3 281 363 2.0E-07

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm Nuclear localization signal 0.6978 0.3602 0.2153 0.1124 0.1008 0.0201 0.073 0.0289 0.1678 0.03

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup3100
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|6085
Ophiocordyceps australis map64 (Brazil) OphauB2|7661
Ophiocordyceps camponoti-floridani Ophcf2|00405
Ophiocordyceps camponoti-rufipedis Ophun1|3977
Ophiocordyceps kimflemingae Ophio5|6347 (this protein)
Ophiocordyceps subramaniannii Hirsu2|54

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|6347
MVSDEHYELCLPILQDPSFEDEDRTDRLEELLKKETNLSGSALENVVLDAMWRYREASGASASPPPIRQSILRRP
SPASWRGSPTPLNGSPRLGVSPLAPPGFVSTFTRTKSSTASPFSSPRASPRLALATPAIPHSPNLNAYEFASDST
PAAEINGDYQTENVEWLVNDDAASVSSSVGTSSGLNAAAPEFSSMSSQQADMSPYDMLRSILGQTRTDDEIEASL
ATHGYDLSATITSIMESQARGGGLMAVPPIDEPKGVLIGKSISAEGRPTTPAGQQKTTIVCKFYLSTGQCLRADC
RFSHDLSNHLCKYWVMGSCLAGDTCIFSHDPSTLLNKVALEENGSDSARNQESPALQDVNSFPCLQEDKSGQKGD
GAGANAVGLPTPSGPRHLYGTEAPRLRSRPVSRQQAKETTTSAPAPDDNEAFPSLGSASARQGKKHHGKRGGHGH
GHKENLAPSSLADIVRRTPSPAPGPTRPESRKGVQNGNGRHGGENSAAAQAISSPKHIPWLETGERANKAYLKAR
QEAIKHGGLRNKFLQSAAQAWNRNDARAAKALSLRGQSENDLMRKAHREAARELYEQRNKGGINGGSEIYVDLHG
LHPDEAVDYLERTLLENSRETRPVYAITGTGHHSKSGKDKVGRAIRSYLGEWRYAYREFSVPGDRNSMGGILGVD
ARSWDKSLTREKGGQEGSKVDILSQGVEIGDGKVRLLVRDPPKGPSGRR
Coding >Ophio5|6347
ATGGTGTCCGACGAGCACTACGAGCTGTGCCTGCCCATCCTGCAGGACCCTTCGTTCGAAGACGAGGATAGGACG
GACAGGCTCGAGGAGCTACTCAAGAAAGAGACGAACCTGTCTGGCTCCGCGCTCGAGAACGTCGTTCTCGATGCC
ATGTGGAGGTATCGCGAGGCGAGTGGAGCGTCGGCATCGCCTCCGCCAATCCGCCAGTCCATCTTGCGCCGTCCT
TCTCCGGCATCCTGGCGCGGATCACCGACGCCCTTGAACGGATCCCCGCGGCTGGGCGTGAGCCCTCTGGCTCCT
CCCGGCTTCGTGTCCACCTTTACACGAACGAAGTCGTCGACGGCCTCTCCTTTCTCGTCGCCCCGTGCCTCCCCG
CGCCTCGCCCTGGCGACACCGGCCATACCGCACAGTCCGAACCTCAACGCCTACGAGTTTGCTAGCGACTCTACC
CCCGCAGCCGAGATCAATGGCGATTATCAGACGGAGAATGTCGAATGGCTCGTCAACGACGATGCTGCTAGCGTT
TCGTCGTCGGTCGGCACGTCGAGCGGGCTGAACGCCGCCGCACCCGAGTTCTCCTCCATGTCCTCGCAGCAGGCC
GACATGTCTCCTTACGACATGCTCCGCTCCATCCTTGGACAAACCCGGACGGATGATGAGATTGAGGCCTCACTC
GCCACACACGGCTACGACCTGAGCGCCACCATCACGTCCATAATGGAGAGCCAGGCCCGTGGAGGAGGGCTTATG
GCCGTACCTCCGATCGACGAGCCAAAGGGTGTGCTAATAGGAAAGTCCATCTCTGCTGAAGGACGCCCCACGACA
CCCGCGGGCCAGCAGAAGACGACAATCGTCTGCAAGTTTTACCTATCCACGGGCCAGTGTCTCCGCGCCGACTGC
CGCTTCAGTCACGATCTGAGCAACCATCTCTGCAAGTACTGGGTTATGGGAAGTTGTCTCGCCGGCGATACATGC
ATATTCTCTCACGATCCCTCGACGCTACTGAACAAGGTGGCCCTCGAAGAGAACGGAAGCGACTCGGCCAGGAAT
CAGGAAAGCCCTGCATTGCAGGATGTCAACTCGTTCCCTTGCTTACAGGAAGACAAATCGGGACAAAAGGGCGAC
GGCGCCGGCGCCAACGCGGTGGGCTTGCCTACCCCGTCGGGGCCGCGTCACCTCTACGGCACCGAGGCTCCGCGG
CTGAGATCGCGACCTGTCAGCCGACAGCAAGCCAAGGAGACGACGACGTCGGCCCCGGCTCCGGACGACAATGAG
GCATTCCCATCGCTGGGGTCGGCCTCGGCGAGGCAAGGCAAGAAGCACCACGGAAAGCGCGGCGGCCACGGTCAT
GGGCACAAGGAGAACCTGGCACCCAGCTCGCTGGCAGACATTGTCCGAAGGACGCCCTCGCCGGCGCCTGGGCCG
ACGCGGCCCGAATCGAGAAAGGGGGTTCAGAACGGCAACGGGCGCCACGGCGGCGAGAACAGCGCGGCGGCGCAG
GCCATCTCCAGCCCCAAGCACATTCCGTGGCTGGAGACGGGCGAGCGGGCGAACAAGGCGTACCTAAAGGCCCGT
CAAGAAGCCATTAAGCATGGCGGGCTTCGCAACAAGTTTTTGCAAAGCGCGGCGCAGGCGTGGAACCGCAACGAC
GCGAGGGCGGCCAAGGCGCTGAGCCTCCGCGGGCAGAGCGAGAACGACTTGATGCGGAAGGCGCACCGAGAGGCG
GCGCGCGAGCTGTACGAGCAACGGAACAAGGGCGGCATCAACGGCGGGTCGGAGATCTACGTCGACCTCCACGGA
CTGCATCCGGACGAGGCGGTGGATTACCTGGAGAGGACGCTGCTGGAGAACAGCAGGGAGACGCGCCCCGTCTAC
GCCATCACCGGCACAGGCCATCACAGCAAGAGCGGTAAGGACAAGGTGGGCAGGGCGATCCGCAGCTATCTCGGC
GAGTGGCGATACGCATACCGCGAGTTCTCGGTGCCGGGCGATCGCAACAGCATGGGCGGGATCCTGGGCGTCGAC
GCGCGCAGCTGGGACAAGTCGTTGACGCGGGAAAAGGGAGGTCAAGAGGGATCCAAGGTGGACATACTCAGCCAG
GGCGTGGAGATTGGGGACGGCAAGGTGAGGCTGCTGGTGCGGGATCCTCCCAAGGGACCGAGCGGGCGACGA
Transcript >Ophio5|6347
ATGGTGTCCGACGAGCACTACGAGCTGTGCCTGCCCATCCTGCAGGACCCTTCGTTCGAAGACGAGGATAGGACG
GACAGGCTCGAGGAGCTACTCAAGAAAGAGACGAACCTGTCTGGCTCCGCGCTCGAGAACGTCGTTCTCGATGCC
ATGTGGAGGTATCGCGAGGCGAGTGGAGCGTCGGCATCGCCTCCGCCAATCCGCCAGTCCATCTTGCGCCGTCCT
TCTCCGGCATCCTGGCGCGGATCACCGACGCCCTTGAACGGATCCCCGCGGCTGGGCGTGAGCCCTCTGGCTCCT
CCCGGCTTCGTGTCCACCTTTACACGAACGAAGTCGTCGACGGCCTCTCCTTTCTCGTCGCCCCGTGCCTCCCCG
CGCCTCGCCCTGGCGACACCGGCCATACCGCACAGTCCGAACCTCAACGCCTACGAGTTTGCTAGCGACTCTACC
CCCGCAGCCGAGATCAATGGCGATTATCAGACGGAGAATGTCGAATGGCTCGTCAACGACGATGCTGCTAGCGTT
TCGTCGTCGGTCGGCACGTCGAGCGGGCTGAACGCCGCCGCACCCGAGTTCTCCTCCATGTCCTCGCAGCAGGCC
GACATGTCTCCTTACGACATGCTCCGCTCCATCCTTGGACAAACCCGGACGGATGATGAGATTGAGGCCTCACTC
GCCACACACGGCTACGACCTGAGCGCCACCATCACGTCCATAATGGAGAGCCAGGCCCGTGGAGGAGGGCTTATG
GCCGTACCTCCGATCGACGAGCCAAAGGGTGTGCTAATAGGAAAGTCCATCTCTGCTGAAGGACGCCCCACGACA
CCCGCGGGCCAGCAGAAGACGACAATCGTCTGCAAGTTTTACCTATCCACGGGCCAGTGTCTCCGCGCCGACTGC
CGCTTCAGTCACGATCTGAGCAACCATCTCTGCAAGTACTGGGTTATGGGAAGTTGTCTCGCCGGCGATACATGC
ATATTCTCTCACGATCCCTCGACGCTACTGAACAAGGTGGCCCTCGAAGAGAACGGAAGCGACTCGGCCAGGAAT
CAGGAAAGCCCTGCATTGCAGGATGTCAACTCGTTCCCTTGCTTACAGGAAGACAAATCGGGACAAAAGGGCGAC
GGCGCCGGCGCCAACGCGGTGGGCTTGCCTACCCCGTCGGGGCCGCGTCACCTCTACGGCACCGAGGCTCCGCGG
CTGAGATCGCGACCTGTCAGCCGACAGCAAGCCAAGGAGACGACGACGTCGGCCCCGGCTCCGGACGACAATGAG
GCATTCCCATCGCTGGGGTCGGCCTCGGCGAGGCAAGGCAAGAAGCACCACGGAAAGCGCGGCGGCCACGGTCAT
GGGCACAAGGAGAACCTGGCACCCAGCTCGCTGGCAGACATTGTCCGAAGGACGCCCTCGCCGGCGCCTGGGCCG
ACGCGGCCCGAATCGAGAAAGGGGGTTCAGAACGGCAACGGGCGCCACGGCGGCGAGAACAGCGCGGCGGCGCAG
GCCATCTCCAGCCCCAAGCACATTCCGTGGCTGGAGACGGGCGAGCGGGCGAACAAGGCGTACCTAAAGGCCCGT
CAAGAAGCCATTAAGCATGGCGGGCTTCGCAACAAGTTTTTGCAAAGCGCGGCGCAGGCGTGGAACCGCAACGAC
GCGAGGGCGGCCAAGGCGCTGAGCCTCCGCGGGCAGAGCGAGAACGACTTGATGCGGAAGGCGCACCGAGAGGCG
GCGCGCGAGCTGTACGAGCAACGGAACAAGGGCGGCATCAACGGCGGGTCGGAGATCTACGTCGACCTCCACGGA
CTGCATCCGGACGAGGCGGTGGATTACCTGGAGAGGACGCTGCTGGAGAACAGCAGGGAGACGCGCCCCGTCTAC
GCCATCACCGGCACAGGCCATCACAGCAAGAGCGGTAAGGACAAGGTGGGCAGGGCGATCCGCAGCTATCTCGGC
GAGTGGCGATACGCATACCGCGAGTTCTCGGTGCCGGGCGATCGCAACAGCATGGGCGGGATCCTGGGCGTCGAC
GCGCGCAGCTGGGACAAGTCGTTGACGCGGGAAAAGGGAGGTCAAGAGGGATCCAAGGTGGACATACTCAGCCAG
GGCGTGGAGATTGGGGACGGCAAGGTGAGGCTGCTGGTGCGGGATCCTCCCAAGGGACCGAGCGGGCGACGATGA
Gene >Ophio5|6347
ATGGTGTCCGACGAGCACTACGAGCTGTGCCTGCCCATCCTGCAGGACCCTTCGTTCGAAGACGAGGATAGGACG
GACAGGCTCGAGGAGCTACTCAAGAAAGAGACGAACCTGTCTGGCTCCGCGCTCGAGAACGTCGTTCTCGATGCC
ATGTGGAGGTATCGCGAGGCGAGTGGAGCGTCGGCATCGCCTCCGCCAATCCGCCAGTCCATCTTGCGCCGTCCT
TCTCCGGCATCCTGGCGCGGATCACCGACGCCCTTGAACGGATCCCCGCGGCTGGGCGTGAGCCCTCTGGCTCCT
CCCGGCTTCGTGTCCACCTTTACACGAACGAAGTCGTCGACGGCCTCTCCTTTCTCGTCGCCCCGTGCCTCCCCG
CGCCTCGCCCTGGCGACACCGGCCATACCGCACAGTCCGAACCTCAACGCCTACGAGTTTGCTAGCGACTCTACC
CCCGCAGCCGAGATCAATGGCGATTATCAGACGGAGAATGTCGAATGGCTCGTCAACGACGATGCTGCTAGCGTT
TCGTCGTCGGTCGGCACGTCGAGCGGGCTGAACGCCGCCGCACCCGAGTTCTCCTCCATGTCCTCGCAGCAGGCC
GACATGTCTCCTTACGACATGCTCCGCTCCATCCTTGGACAAACCCGGACGGATGATGAGATTGAGGCCTCACTC
GCCACACACGGCTACGACCTGAGCGCCACCATCACGTCCATAATGGAGAGCCAGGCCCGTGGAGGAGGGCTTATG
GCCGTACCTCCGATCGACGAGCCAAAGGGTGTGCTAATAGGAAAGTCCATCTCTGCTGAAGGACGCCCCACGACA
CCCGCGGGCCAGCAGAAGACGACAATCGTCTGCAAGTTTTACCTATCCACGGGCCAGTGTCTCCGCGCCGACTGC
CGCTTCAGTCACGATCTGAGCAACCATCTCTGCAAGTGGGTCGCCCAATGCTTTCCCTTCGCTCACCACCTCGAT
AGCTGCCTCCAGACAAGCAGAGCTGACACTTTTCCTCGTCAGGTACTGGGTTATGGGAAGTTGTCTCGCCGGCGA
TACATGCATATTCTCTCACGATCCCTCGACGCTACTGAACAAGGTGGCCCTCGAAGAGAACGGAAGCGACTCGGC
CAGGAATCAGGAAAGCCCTGCATTGCAGGATGTCAACTCGTTCCCTTGCTTACAGGAAGACAAATCGGGACAAAA
GGGCGACGGCGCCGGCGCCAACGCGGTGGGCTTGCCTACCCCGTCGGGGCCGCGTCACCTCTACGGCACCGAGGC
TCCGCGGCTGAGATCGCGACCTGTCAGCCGACAGCAAGCCAAGGAGACGACGACGTCGGCCCCGGCTCCGGACGA
CAATGAGGCATTCCCATCGCTGGGGTCGGCCTCGGCGAGGCAAGGCAAGAAGCACCACGGAAAGCGCGGCGGCCA
CGGTCATGGGCACAAGGAGAACCTGGCACCCAGCTCGCTGGCAGACATTGTCCGAAGGACGCCCTCGCCGGCGCC
TGGGCCGACGCGGCCCGAATCGAGAAAGGGGGTTCAGAACGGCAACGGGCGCCACGGCGGCGAGAACAGCGCGGC
GGCGCAGGCCATCTCCAGCCCCAAGCACATTCCGTGGCTGGAGACGGGCGAGCGGGCGAACAAGGCGTACCTAAA
GGCCCGTCAAGAAGCCATTAAGCATGGCGGGCTTCGCAACAAGTTTTTGCAAAGGTAGGTCTACGGGGCATCCCC
GGGCGAGCATGCGATGGGCACGGGCTGACCGGGAACGATAGCGCGGCGCAGGCGTGGAACCGCAACGACGCGAGG
GCGGCCAAGGCGCTGAGCCTCCGCGGGCAGAGCGAGAACGACTTGATGCGGAAGGCGCACCGAGAGGCGGCGCGC
GAGCTGTACGAGCAACGGAACAAGGGCGGCATCAACGGCGGGTCGGAGATCTACGTCGACCTCCACGGACTGCAT
CCGGACGAGGCGGTGGATTACCTGGAGAGGACGCTGCTGGAGAACAGCAGGGAGACGCGCCCCGTCTACGCCATC
ACCGGCACAGGCCATCACAGCAAGAGCGGTAAGGACAAGGTGGGCAGGGCGATCCGCAGCTATCTCGGCGAGTGG
CGATACGCATACCGCGAGTTCTCGGTGCCGGGCGATCGCAACAGCATGGGCGGGATCCTGGGCGTCGACGCGCGC
AGCTGGGACAAGTCGTTGACGCGGGAAAAGGGAGGTCAAGAGGGATCCAAGGTGGACATACTCAGCCAGGGCGTG
GAGATTGGGGACGGCAAGGTGAGGCTGCTGGTGCGGGATCCTCCCAAGGGACCGAGCGGGCGACGATGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail