Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|6341
Gene name
Locationscaffold_55:16697..18773
Strand-
Gene length (bp)2076
Transcript length (bp)2019
Coding sequence length (bp)2016
Protein length (aa) 672

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF05064 Nsp1_C Nsp1-like C-terminal region 6.2E-39 449 554
PF13634 Nucleoporin_FG Nucleoporin FG repeat region 6.2E+01 9 90
PF13634 Nucleoporin_FG Nucleoporin FG repeat region 8.3E-05 94 181
PF13634 Nucleoporin_FG Nucleoporin FG repeat region 4.7E-02 275 340
PF13634 Nucleoporin_FG Nucleoporin FG repeat region 2.2E-04 345 422

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|G0SBQ3|NSP1_CHATD Nucleoporin NSP1 OS=Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719) GN=NSP1 PE=1 SV=1 3 670 2.0E-108
sp|Q10168|NSP1_SCHPO Nucleoporin nsp1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=nsp1 PE=1 SV=1 331 644 8.0E-36
sp|Q63850|NUP62_MOUSE Nuclear pore glycoprotein p62 OS=Mus musculus GN=Nup62 PE=1 SV=2 447 644 3.0E-34
sp|P37198|NUP62_HUMAN Nuclear pore glycoprotein p62 OS=Homo sapiens GN=NUP62 PE=1 SV=3 464 644 3.0E-34
sp|P17955|NUP62_RAT Nuclear pore glycoprotein p62 OS=Rattus norvegicus GN=Nup62 PE=1 SV=1 447 644 1.0E-33
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|G0SBQ3|NSP1_CHATD Nucleoporin NSP1 OS=Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719) GN=NSP1 PE=1 SV=1 3 670 2.0E-108
sp|Q10168|NSP1_SCHPO Nucleoporin nsp1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=nsp1 PE=1 SV=1 331 644 8.0E-36
sp|Q63850|NUP62_MOUSE Nuclear pore glycoprotein p62 OS=Mus musculus GN=Nup62 PE=1 SV=2 447 644 3.0E-34
sp|P37198|NUP62_HUMAN Nuclear pore glycoprotein p62 OS=Homo sapiens GN=NUP62 PE=1 SV=3 464 644 3.0E-34
sp|P17955|NUP62_RAT Nuclear pore glycoprotein p62 OS=Rattus norvegicus GN=Nup62 PE=1 SV=1 447 644 1.0E-33
sp|P14907|NSP1_YEAST Nucleoporin NSP1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=NSP1 PE=1 SV=1 398 644 2.0E-31
sp|Q8L7F7|NUP62_ARATH Nuclear pore complex protein NUP62 OS=Arabidopsis thaliana GN=NUP62 PE=1 SV=1 458 639 2.0E-22
sp|Q9H1M0|N62CL_HUMAN Nucleoporin-62 C-terminal-like protein OS=Homo sapiens GN=NUP62CL PE=1 SV=3 457 547 3.0E-07
sp|P48837|NUP57_YEAST Nucleoporin NUP57 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=NUP57 PE=1 SV=1 241 418 1.0E-06
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 19 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|6341
MTSFNFVKPSSSSQPSDATSTPAPAAGSLFGAVTAPTKTVFCFSPLGGTANATGPASTGGFAPEQQQQQQQQQQG
ADGNAQKPDATSSAPTLPFGASAPSTGTLFGANSSATPSSTGNPFGTMNPATSTPTTLTPKAGGLFGNLTGKPAT
NLFGAAAGSATPGGGSILSQKNDQSSAFTAAASTPAKPMFPLASTTPAGAPPADSSQPAASSSLQVTAPASSQGL
FSLAKAGSNAPGAGESVLGSNSAAPPAGGLLGNLGGNLAPGSSPAPAAEGSATPKLGSSLFGGMTTAPAAAGATT
IGSGLFGSATATSTASTTGATKAPSGGMFGNTSTPAATTSAATPATSSTSAGLFGNAQPTASASASNTASSLFGA
PAAASASQPTSAGGPTVAAGGLFGAKPATGGTSQTAGGLFGAKTATEGVDKAQDGQPAKPAAQNGTAGALGASTS
GPTSQMPRLKNKTMEDIITRWASDLAKYQKDFKEQATVVSTWDRNLVNNGEKIQKLYLDTFEAERASHEIERQLA
AVESQQDELEAWLDRYEAEVQDMFVKQVGPGEQLAGPDQERERTYKLAEKLTQQLDEKSRDLSKMVKDINDISGS
LTKGAKVEDPLSQIVRVLNGHLTQLQWIDAHAAALQAKVAAAQKSSVALNSHYAGVENDAAESFYRSYMGRR
Coding >Ophio5|6341
ATGACCTCCTTCAACTTCGTGAAGCCAAGCTCGTCGAGCCAACCGTCGGACGCGACTTCGACTCCGGCACCCGCT
GCTGGCAGTCTCTTCGGCGCTGTTACGGCCCCTACCAAAACCGTCTTCTGCTTCAGCCCGCTAGGAGGCACAGCC
AACGCCACGGGCCCCGCCAGCACAGGAGGCTTTGCCCCCGAGCAGCAGCAGCAGCAGCAGCAGCAGCAGCAGGGG
GCGGATGGAAACGCGCAGAAGCCGGATGCCACTTCTTCGGCTCCGACGCTGCCTTTCGGCGCAAGCGCGCCCTCG
ACTGGGACCTTGTTTGGGGCCAACAGCTCTGCTACGCCGTCGTCCACCGGCAATCCCTTTGGCACCATGAATCCA
GCCACTTCTACGCCGACAACCTTGACTCCAAAGGCTGGAGGACTTTTCGGCAACTTGACCGGCAAGCCGGCGACG
AACCTGTTTGGCGCTGCTGCTGGCAGCGCAACCCCGGGGGGCGGCTCCATCCTTTCGCAGAAGAATGATCAATCC
AGTGCATTCACGGCGGCAGCGTCCACTCCTGCGAAGCCCATGTTTCCTCTTGCCTCCACTACTCCGGCGGGGGCC
CCTCCAGCAGATTCCTCACAGCCTGCCGCCTCCTCGTCATTGCAAGTTACGGCGCCCGCGTCTTCTCAGGGATTA
TTCAGCCTCGCGAAGGCAGGTAGCAACGCCCCTGGTGCTGGGGAGAGCGTGTTGGGCTCAAACTCCGCAGCACCT
CCCGCTGGGGGCCTGCTCGGGAACTTGGGGGGTAATTTGGCGCCGGGCTCGTCTCCCGCGCCGGCGGCGGAGGGC
TCTGCAACTCCCAAACTGGGCAGCTCCCTGTTCGGTGGGATGACGACAGCACCCGCTGCGGCTGGAGCCACGACA
ATCGGGAGTGGACTTTTCGGCAGCGCAACGGCCACGTCTACCGCCTCGACAACTGGCGCCACCAAGGCTCCCAGC
GGTGGCATGTTCGGCAACACGTCGACCCCTGCAGCTACGACATCCGCTGCCACACCGGCTACTTCATCGACTTCA
GCCGGCTTATTTGGGAACGCTCAGCCAACCGCCTCCGCCTCCGCGTCAAATACGGCCTCTTCGCTCTTTGGAGCT
CCAGCCGCTGCCAGCGCTTCACAGCCGACGTCGGCCGGGGGACCGACAGTGGCCGCAGGCGGGCTTTTTGGGGCC
AAGCCGGCCACTGGGGGCACATCTCAGACCGCAGGCGGACTGTTTGGGGCCAAGACGGCCACTGAAGGCGTGGAC
AAGGCTCAGGATGGCCAGCCAGCCAAGCCCGCAGCGCAGAACGGGACTGCGGGCGCGCTGGGCGCCTCGACAAGC
GGCCCAACCTCGCAGATGCCCCGGCTGAAGAACAAGACCATGGAGGACATCATCACCCGATGGGCCTCGGATCTC
GCCAAATACCAAAAGGATTTCAAGGAGCAGGCCACGGTGGTGTCGACTTGGGATCGAAACCTAGTCAATAATGGA
GAGAAGATTCAGAAGTTATACCTCGACACTTTCGAGGCCGAGAGAGCGAGCCACGAGATCGAACGACAGCTGGCG
GCGGTGGAAAGCCAGCAGGACGAGCTCGAGGCTTGGCTGGACCGGTACGAAGCAGAAGTGCAAGACATGTTCGTC
AAGCAAGTCGGCCCGGGCGAGCAGCTGGCCGGTCCAGACCAGGAGCGAGAGCGGACCTACAAGCTGGCCGAGAAG
CTCACGCAGCAGCTCGACGAAAAGTCGCGAGACCTTTCCAAGATGGTCAAGGACATTAACGACATCTCGGGAAGC
CTGACCAAGGGAGCCAAGGTTGAGGACCCATTGAGCCAGATTGTACGCGTACTCAACGGCCACCTCACCCAGCTG
CAGTGGATCGACGCCCACGCCGCGGCGCTGCAGGCGAAGGTGGCGGCGGCACAGAAGTCGAGCGTGGCTCTGAAC
AGCCATTACGCCGGGGTGGAAAACGACGCCGCAGAGAGCTTCTACCGGTCGTACATGGGGCGACGG
Transcript >Ophio5|6341
ATGACCTCCTTCAACTTCGTGAAGCCAAGCTCGTCGAGCCAACCGTCGGACGCGACTTCGACTCCGGCACCCGCT
GCTGGCAGTCTCTTCGGCGCTGTTACGGCCCCTACCAAAACCGTCTTCTGCTTCAGCCCGCTAGGAGGCACAGCC
AACGCCACGGGCCCCGCCAGCACAGGAGGCTTTGCCCCCGAGCAGCAGCAGCAGCAGCAGCAGCAGCAGCAGGGG
GCGGATGGAAACGCGCAGAAGCCGGATGCCACTTCTTCGGCTCCGACGCTGCCTTTCGGCGCAAGCGCGCCCTCG
ACTGGGACCTTGTTTGGGGCCAACAGCTCTGCTACGCCGTCGTCCACCGGCAATCCCTTTGGCACCATGAATCCA
GCCACTTCTACGCCGACAACCTTGACTCCAAAGGCTGGAGGACTTTTCGGCAACTTGACCGGCAAGCCGGCGACG
AACCTGTTTGGCGCTGCTGCTGGCAGCGCAACCCCGGGGGGCGGCTCCATCCTTTCGCAGAAGAATGATCAATCC
AGTGCATTCACGGCGGCAGCGTCCACTCCTGCGAAGCCCATGTTTCCTCTTGCCTCCACTACTCCGGCGGGGGCC
CCTCCAGCAGATTCCTCACAGCCTGCCGCCTCCTCGTCATTGCAAGTTACGGCGCCCGCGTCTTCTCAGGGATTA
TTCAGCCTCGCGAAGGCAGGTAGCAACGCCCCTGGTGCTGGGGAGAGCGTGTTGGGCTCAAACTCCGCAGCACCT
CCCGCTGGGGGCCTGCTCGGGAACTTGGGGGGTAATTTGGCGCCGGGCTCGTCTCCCGCGCCGGCGGCGGAGGGC
TCTGCAACTCCCAAACTGGGCAGCTCCCTGTTCGGTGGGATGACGACAGCACCCGCTGCGGCTGGAGCCACGACA
ATCGGGAGTGGACTTTTCGGCAGCGCAACGGCCACGTCTACCGCCTCGACAACTGGCGCCACCAAGGCTCCCAGC
GGTGGCATGTTCGGCAACACGTCGACCCCTGCAGCTACGACATCCGCTGCCACACCGGCTACTTCATCGACTTCA
GCCGGCTTATTTGGGAACGCTCAGCCAACCGCCTCCGCCTCCGCGTCAAATACGGCCTCTTCGCTCTTTGGAGCT
CCAGCCGCTGCCAGCGCTTCACAGCCGACGTCGGCCGGGGGACCGACAGTGGCCGCAGGCGGGCTTTTTGGGGCC
AAGCCGGCCACTGGGGGCACATCTCAGACCGCAGGCGGACTGTTTGGGGCCAAGACGGCCACTGAAGGCGTGGAC
AAGGCTCAGGATGGCCAGCCAGCCAAGCCCGCAGCGCAGAACGGGACTGCGGGCGCGCTGGGCGCCTCGACAAGC
GGCCCAACCTCGCAGATGCCCCGGCTGAAGAACAAGACCATGGAGGACATCATCACCCGATGGGCCTCGGATCTC
GCCAAATACCAAAAGGATTTCAAGGAGCAGGCCACGGTGGTGTCGACTTGGGATCGAAACCTAGTCAATAATGGA
GAGAAGATTCAGAAGTTATACCTCGACACTTTCGAGGCCGAGAGAGCGAGCCACGAGATCGAACGACAGCTGGCG
GCGGTGGAAAGCCAGCAGGACGAGCTCGAGGCTTGGCTGGACCGGTACGAAGCAGAAGTGCAAGACATGTTCGTC
AAGCAAGTCGGCCCGGGCGAGCAGCTGGCCGGTCCAGACCAGGAGCGAGAGCGGACCTACAAGCTGGCCGAGAAG
CTCACGCAGCAGCTCGACGAAAAGTCGCGAGACCTTTCCAAGATGGTCAAGGACATTAACGACATCTCGGGAAGC
CTGACCAAGGGAGCCAAGGTTGAGGACCCATTGAGCCAGATTGTACGCGTACTCAACGGCCACCTCACCCAGCTG
CAGTGGATCGACGCCCACGCCGCGGCGCTGCAGGCGAAGGTGGCGGCGGCACAGAAGTCGAGCGTGGCTCTGAAC
AGCCATTACGCCGGGGTGGAAAACGACGCCGCAGAGAGCTTCTACCGGTCGTACATGGGGCGACGGTGA
Gene >Ophio5|6341
ATGACCTCCTTCAACTTCGTGAAGCCAAGCTCGTCGAGCCAACCGTCGGACGCGACTTCGACTCCGGCACCCGCT
GCTGGCAGTCTCTTCGGCGCTGTTACGGCCCCTACCAAAACCGTCTTCTGCTTCAGCCCGCTAGGAGGCACAGCC
AACGCCACGGGCCCCGCCAGCACAGGAGGCTTTGCCCCCGAGCAGCAGCAGCAGCAGCAGCAGCAGCAGCAGGGG
GCGGATGGAAACGCGCAGAAGCCGGATGCCACTTCTTCGGCTCCGACGCTGCCTTTCGGCGCAAGCGCGCCCTCG
ACTGGGACCTTGTTTGGGGCCAACAGCTCTGCTACGCCGTCGTCCACCGGCAATCCCTTTGGCACCATGAATCCA
GCCACTTCTACGCCGACAACCTTGACTCCAAAGGCTGGAGGACTTTTCGGCAACTTGACCGGCAAGCCGGCGACG
AACCTGTTTGGCGCTGCTGCTGGCAGCGCAACCCCGGGGGGCGGCTCCATCCTTTCGCAGAAGAATGATCAATCC
AGTGCATTCACGGCGGCAGCGTCCACTCCTGCGAAGCCCATGTTTCCTCTTGCCTCCACTACTCCGGCGGGGGCC
CCTCCAGCAGATTCCTCACAGCCTGCCGCCTCCTCGTCATTGCAAGTTACGGCGCCCGCGTCTTCTCAGGGATTA
TTCAGCCTCGCGAAGGCAGGTAGCAACGCCCCTGGTGCTGGGGAGAGCGTGTTGGGCTCAAACTCCGCAGCACCT
CCCGCTGGGGGCCTGCTCGGGAACTTGGGGGGTAATTTGGCGCCGGGCTCGTCTCCCGCGCCGGCGGCGGAGGGC
TCTGCAACTCCCAAACTGGGCAGCTCCCTGTTCGGTGGGATGACGACAGCACCCGCTGCGGCTGGAGCCACGACA
ATCGGGAGTGGACTTTTCGGCAGCGCAACGGCCACGTCTACCGCCTCGACAACTGGCGCCACCAAGGCTCCCAGC
GGTGGCATGTTCGGCAACACGTCGACCCCTGCAGCTACGACATCCGCTGCCACACCGGCTACTTCATCGACTTCA
GCCGGCTTATTTGGGAACGCTCAGCCAACCGCCTCCGCCTCCGCGTCAAATACGGCCTCTTCGCTCTTTGGAGCT
CCAGCCGCTGCCAGCGCTTCACAGCCGACGTCGGCCGGGGGACCGACAGTGGCCGCAGGCGGGCTTTTTGGGGCC
AAGCCGGCCACTGGGGGCACATCTCAGACCGCAGGCGGACTGTTTGGGGCCAAGACGGCCACTGAAGGCGTGGAC
AAGGCTCAGGATGGCCAGCCAGCCAAGCCCGCAGCGCAGAACGGGACTGCGGGCGCGCTGGGCGCCTCGACAAGC
GGCCCAACCTCGCAGATGCCCCGGCTGAAGAACAAGACCATGGAGGACATCATCACCCGATGGGCCTCGGATCTC
GCCAAATACCAAAAGGATTTCAAGGAGCAGGCCACGGTGGTGTCGACTTGGGATCGAAACCTAGTCAATAATGGA
GAGAAGATTCAGAAGTTATACCTCGACACTTTCGAGGCCGAGAGAGCGAGCCACGAGATCGAACGACAGCTGGCG
GCGGTGGAAAGCCAGCAGGACGAGCTCGAGGCTTGGCTGGACCGGTACGAAGCAGAAGTGCAAGACATGTTCGTC
AAGCAAGTCGGCCCGGGCGAGCAGCTGGCCGGTCCAGACCAGGAGCGAGAGCGGACCTACAAGCTGGCCGAGAAG
CTCACGCAGCAGCTCGACGAAAAGTCGCGAGACCTTTCCAAGATGGTCAAGGACATTAACGACATCTCGGGAAGC
CTGACCAAGGGAGCCAAGGTTGAGGACCCAGTAAGCATGGCCGCCTAGTGAAGCTCCGTCCGCGCCGAAGCTGAC
TTGTGACGACAGTTGAGCCAGATTGTACGCGTACTCAACGGCCACCTCACCCAGCTGCAGTGGATCGACGCCCAC
GCCGCGGCGCTGCAGGCGAAGGTGGCGGCGGCACAGAAGTCGAGCGTGGCTCTGAACAGCCATTACGCCGGGGTG
GAAAACGACGCCGCAGAGAGCTTCTACCGGTCGTACATGGGGCGACGGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail