Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|6314
Gene name
Locationscaffold_546:7561..8775
Strand-
Gene length (bp)1214
Transcript length (bp)1113
Coding sequence length (bp)1110
Protein length (aa) 370

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) 9.8E-15 157 226

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O74978|YQL5_SCHPO Uncharacterized RNA-binding protein C1827.05c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC1827.05c PE=3 SV=1 82 288 4.0E-41
sp|Q6GL69|MK67I_XENTR MKI67 FHA domain-interacting nucleolar phosphoprotein-like OS=Xenopus tropicalis GN=nifk PE=2 SV=1 155 295 3.0E-29
sp|Q7SYS2|MK67I_XENLA MKI67 FHA domain-interacting nucleolar phosphoprotein-like OS=Xenopus laevis GN=nifk PE=2 SV=2 155 295 2.0E-27
sp|Q8JIY8|MK67I_DANRE MKI67 FHA domain-interacting nucleolar phosphoprotein OS=Danio rerio GN=nifk PE=2 SV=2 155 295 3.0E-25
sp|Q3SZM1|MK67I_BOVIN MKI67 FHA domain-interacting nucleolar phosphoprotein OS=Bos taurus GN=NIFK PE=2 SV=1 155 250 5.0E-25
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O74978|YQL5_SCHPO Uncharacterized RNA-binding protein C1827.05c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC1827.05c PE=3 SV=1 82 288 4.0E-41
sp|Q6GL69|MK67I_XENTR MKI67 FHA domain-interacting nucleolar phosphoprotein-like OS=Xenopus tropicalis GN=nifk PE=2 SV=1 155 295 3.0E-29
sp|Q7SYS2|MK67I_XENLA MKI67 FHA domain-interacting nucleolar phosphoprotein-like OS=Xenopus laevis GN=nifk PE=2 SV=2 155 295 2.0E-27
sp|Q8JIY8|MK67I_DANRE MKI67 FHA domain-interacting nucleolar phosphoprotein OS=Danio rerio GN=nifk PE=2 SV=2 155 295 3.0E-25
sp|Q3SZM1|MK67I_BOVIN MKI67 FHA domain-interacting nucleolar phosphoprotein OS=Bos taurus GN=NIFK PE=2 SV=1 155 250 5.0E-25
sp|P53927|NOP15_YEAST Ribosome biogenesis protein 15 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=NOP15 PE=1 SV=1 155 231 4.0E-24
sp|Q91VE6|MK67I_MOUSE MKI67 FHA domain-interacting nucleolar phosphoprotein OS=Mus musculus GN=Nifk PE=1 SV=1 154 331 8.0E-24
sp|Q5RJM0|MK67I_RAT MKI67 FHA domain-interacting nucleolar phosphoprotein OS=Rattus norvegicus GN=Nifk PE=2 SV=1 155 248 4.0E-23
sp|Q9BYG3|MK67I_HUMAN MKI67 FHA domain-interacting nucleolar phosphoprotein OS=Homo sapiens GN=NIFK PE=1 SV=1 155 250 6.0E-23
sp|Q9M9G6|CTF64_ARATH Cleavage stimulating factor 64 OS=Arabidopsis thaliana GN=CSTF64 PE=1 SV=1 148 234 2.0E-08
sp|Q9SD61|C3H42_ARATH Zinc finger CCCH domain-containing protein 42 OS=Arabidopsis thaliana GN=At3g47120 PE=2 SV=1 156 237 1.0E-07
sp|Q10B98|C3H25_ORYSJ Zinc finger CCCH domain-containing protein 25 OS=Oryza sativa subsp. japonica GN=Os03g0826400 PE=2 SV=1 156 232 4.0E-07
sp|O94290|IST3_SCHPO U2 snRNP component ist3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cwf29 PE=1 SV=1 157 232 8.0E-07
sp|P25299|RNA15_YEAST mRNA 3'-end-processing protein RNA15 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RNA15 PE=1 SV=1 156 236 1.0E-06
sp|Q5SP50|ZCRB1_DANRE Zinc finger CCHC-type and RNA-binding motif-containing protein 1 OS=Danio rerio GN=zcrb1 PE=2 SV=1 154 230 1.0E-06
sp|O22315|SR34_ARATH Serine/arginine-rich-splicing factor SR34 OS=Arabidopsis thaliana GN=SR34 PE=1 SV=1 156 239 2.0E-06
sp|Q9WX37|RBPE_NOSS1 Putative RNA-binding protein RbpE OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=rbpE PE=3 SV=3 157 229 3.0E-06
sp|O43040|CTF1_SCHPO Cleavage and termination factor 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ctf1 PE=1 SV=1 155 234 3.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0003723 RNA binding Yes
GO:0003676 nucleic acid binding No
GO:0097159 organic cyclic compound binding No
GO:0005488 binding No
GO:0003674 molecular_function No
GO:1901363 heterocyclic compound binding No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Nucleus Nuclear localization signal 0.2014 0.8529 0.0811 0.0142 0.0512 0.0159 0.046 0.0043 0.0145 0.0021

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup4897
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|2185
Ophiocordyceps australis map64 (Brazil) OphauB2|6278
Ophiocordyceps camponoti-floridani Ophcf2|04345
Ophiocordyceps kimflemingae Ophio5|6314 (this protein)
Ophiocordyceps subramaniannii Hirsu2|1294

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|6314
MAPSTKKATAAPEPRRSLRSAVKDAGKASSKPKRKAVDESSPVSLKKQKSAKQSSARENLVGKASKGVKSDKPNK
PAQKASAEEAEKSITVAEGSSDSEDEGDNGVLLLADEMDSGDEEEVSSKVALFKPGQAVGKIPAISNDVAKAAKP
SGKRGVIYIGRIPHGFYEYEMRQYLSQFGPVTRIRLSRNKRTGASKHFAFVEFEDESTAEIVAKTMDNYLLFGHI
LKVKMVSGDQIHADLWKGANRRFKKVPWTKLDGQKLAQPRTTTKWETRLLKEREARARRADKLKAIGYEFEAPEL
KTVPLVAPAEMQAVEAAPQEAEGEVVVADVKVPEAAAEQVEETAETMTASKSQKASRKSSKSGKAKRRQA
Coding >Ophio5|6314
ATGGCTCCCAGTACGAAGAAAGCAACAGCCGCGCCTGAGCCTCGCAGGAGCCTGAGATCAGCAGTCAAGGATGCA
GGCAAGGCCTCATCGAAGCCCAAGCGCAAAGCTGTCGATGAATCCTCTCCGGTGTCTCTGAAGAAGCAAAAGTCG
GCAAAGCAGTCATCCGCCCGGGAGAACTTGGTGGGAAAAGCATCCAAAGGCGTCAAGTCGGATAAACCCAACAAG
CCCGCCCAGAAGGCTTCGGCCGAAGAGGCAGAAAAATCAATCACGGTCGCTGAAGGTTCTTCCGATTCGGAAGAT
GAGGGCGACAATGGCGTGCTACTTTTAGCAGATGAGATGGACTCAGGCGACGAGGAAGAGGTGTCGAGCAAAGTC
GCACTGTTCAAGCCCGGACAGGCCGTCGGCAAGATACCGGCCATCTCTAACGACGTGGCTAAAGCTGCCAAGCCG
TCTGGCAAGCGTGGAGTCATCTACATCGGCCGCATTCCCCATGGTTTCTACGAGTACGAAATGAGGCAGTATCTG
TCGCAATTCGGACCTGTCACTCGTATTCGCCTTTCACGAAACAAAAGGACGGGCGCAAGCAAACACTTTGCCTTT
GTCGAATTTGAGGATGAGAGCACAGCCGAAATCGTCGCCAAGACCATGGACAACTACCTTCTGTTTGGGCACATA
CTCAAGGTCAAGATGGTTTCCGGGGACCAGATCCACGCGGACCTGTGGAAAGGTGCGAACAGGAGGTTCAAGAAG
GTGCCGTGGACCAAATTAGATGGTCAAAAGCTCGCCCAGCCCCGGACTACCACCAAATGGGAGACCAGATTGCTG
AAGGAGCGAGAAGCCCGGGCCCGGAGAGCCGACAAGCTTAAAGCTATCGGCTACGAATTCGAGGCCCCCGAATTG
AAAACGGTTCCACTTGTCGCTCCTGCAGAGATGCAGGCTGTTGAGGCGGCTCCTCAGGAAGCCGAAGGTGAGGTT
GTGGTGGCTGATGTTAAGGTGCCAGAAGCGGCAGCTGAGCAGGTGGAGGAGACGGCTGAGACGATGACGGCCTCG
AAGTCCCAGAAGGCCTCGAGGAAGTCGTCAAAGTCTGGCAAGGCGAAGAGGAGGCAGGCA
Transcript >Ophio5|6314
ATGGCTCCCAGTACGAAGAAAGCAACAGCCGCGCCTGAGCCTCGCAGGAGCCTGAGATCAGCAGTCAAGGATGCA
GGCAAGGCCTCATCGAAGCCCAAGCGCAAAGCTGTCGATGAATCCTCTCCGGTGTCTCTGAAGAAGCAAAAGTCG
GCAAAGCAGTCATCCGCCCGGGAGAACTTGGTGGGAAAAGCATCCAAAGGCGTCAAGTCGGATAAACCCAACAAG
CCCGCCCAGAAGGCTTCGGCCGAAGAGGCAGAAAAATCAATCACGGTCGCTGAAGGTTCTTCCGATTCGGAAGAT
GAGGGCGACAATGGCGTGCTACTTTTAGCAGATGAGATGGACTCAGGCGACGAGGAAGAGGTGTCGAGCAAAGTC
GCACTGTTCAAGCCCGGACAGGCCGTCGGCAAGATACCGGCCATCTCTAACGACGTGGCTAAAGCTGCCAAGCCG
TCTGGCAAGCGTGGAGTCATCTACATCGGCCGCATTCCCCATGGTTTCTACGAGTACGAAATGAGGCAGTATCTG
TCGCAATTCGGACCTGTCACTCGTATTCGCCTTTCACGAAACAAAAGGACGGGCGCAAGCAAACACTTTGCCTTT
GTCGAATTTGAGGATGAGAGCACAGCCGAAATCGTCGCCAAGACCATGGACAACTACCTTCTGTTTGGGCACATA
CTCAAGGTCAAGATGGTTTCCGGGGACCAGATCCACGCGGACCTGTGGAAAGGTGCGAACAGGAGGTTCAAGAAG
GTGCCGTGGACCAAATTAGATGGTCAAAAGCTCGCCCAGCCCCGGACTACCACCAAATGGGAGACCAGATTGCTG
AAGGAGCGAGAAGCCCGGGCCCGGAGAGCCGACAAGCTTAAAGCTATCGGCTACGAATTCGAGGCCCCCGAATTG
AAAACGGTTCCACTTGTCGCTCCTGCAGAGATGCAGGCTGTTGAGGCGGCTCCTCAGGAAGCCGAAGGTGAGGTT
GTGGTGGCTGATGTTAAGGTGCCAGAAGCGGCAGCTGAGCAGGTGGAGGAGACGGCTGAGACGATGACGGCCTCG
AAGTCCCAGAAGGCCTCGAGGAAGTCGTCAAAGTCTGGCAAGGCGAAGAGGAGGCAGGCATAA
Gene >Ophio5|6314
ATGGCTCCCAGTACGAAGAAAGCAACAGGTGATTAATGAACACATCACTCGATTTGAACTTGAGGTAACATTTTG
CAGCCGCGCCTGAGCCTCGCAGGAGCCTGAGATCAGCAGTCAAGGATGCAGGCAAGGCCTCATCGAAGCCCAAGC
GCAAAGGTGATTTGCCCGCCACCGTCTGCCGCCTGGCGCACTAAGTCAAGCAAACAGCTGTCGATGAATCCTCTC
CGGTGTCTCTGAAGAAGCAAAAGTCGGCAAAGCAGTCATCCGCCCGGGAGAACTTGGTGGGAAAAGCATCCAAAG
GCGTCAAGTCGGATAAACCCAACAAGCCCGCCCAGAAGGCTTCGGCCGAAGAGGCAGAAAAATCAATCACGGTCG
CTGAAGGTTCTTCCGATTCGGAAGATGAGGGCGACAATGGCGTGCTACTTTTAGCAGATGAGATGGACTCAGGCG
ACGAGGAAGAGGTGTCGAGCAAAGTCGCACTGTTCAAGCCCGGACAGGCCGTCGGCAAGATACCGGCCATCTCTA
ACGACGTGGCTAAAGCTGCCAAGCCGTCTGGCAAGCGTGGAGTCATCTACATCGGCCGCATTCCCCATGGTTTCT
ACGAGTACGAAATGAGGCAGTATCTGTCGCAATTCGGACCTGTCACTCGTATTCGCCTTTCACGAAACAAAAGGA
CGGGCGCAAGCAAACACTTTGCCTTTGTCGAATTTGAGGATGAGAGCACAGCCGAAATCGTCGCCAAGACCATGG
ACAACTACCTTCTGTTTGGGCACATACTCAAGGTCAAGATGGTTTCCGGGGACCAGATCCACGCGGACCTGTGGA
AAGGTGCGAACAGGAGGTTCAAGAAGGTGCCGTGGACCAAATTAGATGGTCAAAAGCTCGCCCAGCCCCGGACTA
CCACCAAATGGGAGACCAGATTGCTGAAGGAGCGAGAAGCCCGGGCCCGGAGAGCCGACAAGCTTAAAGCTATCG
GCTACGAATTCGAGGCCCCCGAATTGAAAACGGTTCCACTTGTCGCTCCTGCAGAGATGCAGGCTGTTGAGGCGG
CTCCTCAGGAAGCCGAAGGTGAGGTTGTGGTGGCTGATGTTAAGGTGCCAGAAGCGGCAGCTGAGCAGGTGGAGG
AGACGGCTGAGACGATGACGGCCTCGAAGTCCCAGAAGGCCTCGAGGAAGTCGTCAAAGTCTGGCAAGGCGAAGA
GGAGGCAGGCATAA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail