Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|6312
Gene name
Locationscaffold_546:3784..4919
Strand+
Gene length (bp)1135
Transcript length (bp)933
Coding sequence length (bp)930
Protein length (aa) 310

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

(None)

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 24 0.5

Transmembrane Domains

Domain # Start End Length
1 5 27 22
2 48 70 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
SC16a Pure fungal culture 26.52 11.45 41.59
CcL In ants, during behavior modification 46.09 22.08 70.10
CcD In ants, recently dead 38.91 18.43 59.38

Differential expression

Label1 Label2 Q-value Significant difference
SC16a CcL 0.035985 yes
SC16a CcD 0.165982 no
CcL CcD 0.558552 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|6312
MAIPWDSILSIAFIIGPIALGKAVTSYRSARNVSRPPKSAVRPVPLRIWPALGLLFLVAAFYLVQTLPALAPENI
FVRTQSRLLTPADVLFNRLASLRPDHALTPHDEALRARLVNIETLVTASTWTDVHGSQWRTIATLAAAFLAAADV
FMVKTYDYKSNTASLRLEDIDFFFWSMRSYRLFALAAFDALLGYLIYLSCTNRAFATPISAPERVDALARGLLSV
KSKMSAMGIVRNTALRDTDLRSRSQAYWIHEVRLMSEVMEERDVVEGVNDALSSRIDMQAVLRDADAYSQAVLQP
LQNLAPDDAS
Coding >Ophio5|6312
ATGGCCATCCCCTGGGACTCAATCCTGTCTATAGCCTTCATTATCGGCCCCATTGCCTTGGGGAAAGCCGTGACG
TCGTATCGCTCCGCCCGCAACGTCTCGCGACCGCCGAAATCCGCCGTACGGCCCGTTCCGCTTCGCATCTGGCCC
GCGCTCGGGCTGCTATTCCTCGTGGCCGCTTTTTATCTTGTGCAGACGCTGCCTGCGCTGGCGCCGGAGAATATC
TTTGTTCGTACGCAGAGTAGGCTGCTTACTCCTGCCGATGTCCTCTTCAACCGACTCGCGTCTTTACGGCCTGAT
CATGCGTTGACGCCCCACGATGAGGCTTTACGCGCAAGGCTCGTCAATATCGAGACCCTCGTTACAGCCTCCACC
TGGACCGACGTCCACGGCTCGCAGTGGCGCACCATCGCCACCCTAGCCGCGGCCTTTCTCGCTGCTGCCGATGTA
TTCATGGTCAAAACCTACGACTACAAGTCCAATACCGCCTCCTTGCGGCTCGAAGACATCGACTTTTTCTTCTGG
TCCATGCGATCATATCGCCTGTTCGCCCTCGCCGCCTTTGACGCTCTACTAGGCTATCTCATCTACCTGTCCTGC
ACAAACCGAGCATTCGCGACGCCGATTTCCGCCCCGGAGCGCGTCGACGCCCTCGCCCGCGGCCTCTTGTCTGTC
AAAAGCAAGATGAGCGCCATGGGCATCGTCAGGAACACGGCTTTGCGTGACACGGATCTGCGGTCGCGCAGTCAG
GCGTATTGGATACACGAGGTTCGCCTCATGAGCGAGGTCATGGAGGAGAGAGACGTCGTCGAGGGCGTCAACGAT
GCCCTGAGCAGCCGCATTGATATGCAGGCTGTGCTCAGGGACGCCGACGCTTACTCCCAAGCTGTCCTGCAACCG
CTGCAGAACCTGGCGCCCGACGATGCATCG
Transcript >Ophio5|6312
ATGGCCATCCCCTGGGACTCAATCCTGTCTATAGCCTTCATTATCGGCCCCATTGCCTTGGGGAAAGCCGTGACG
TCGTATCGCTCCGCCCGCAACGTCTCGCGACCGCCGAAATCCGCCGTACGGCCCGTTCCGCTTCGCATCTGGCCC
GCGCTCGGGCTGCTATTCCTCGTGGCCGCTTTTTATCTTGTGCAGACGCTGCCTGCGCTGGCGCCGGAGAATATC
TTTGTTCGTACGCAGAGTAGGCTGCTTACTCCTGCCGATGTCCTCTTCAACCGACTCGCGTCTTTACGGCCTGAT
CATGCGTTGACGCCCCACGATGAGGCTTTACGCGCAAGGCTCGTCAATATCGAGACCCTCGTTACAGCCTCCACC
TGGACCGACGTCCACGGCTCGCAGTGGCGCACCATCGCCACCCTAGCCGCGGCCTTTCTCGCTGCTGCCGATGTA
TTCATGGTCAAAACCTACGACTACAAGTCCAATACCGCCTCCTTGCGGCTCGAAGACATCGACTTTTTCTTCTGG
TCCATGCGATCATATCGCCTGTTCGCCCTCGCCGCCTTTGACGCTCTACTAGGCTATCTCATCTACCTGTCCTGC
ACAAACCGAGCATTCGCGACGCCGATTTCCGCCCCGGAGCGCGTCGACGCCCTCGCCCGCGGCCTCTTGTCTGTC
AAAAGCAAGATGAGCGCCATGGGCATCGTCAGGAACACGGCTTTGCGTGACACGGATCTGCGGTCGCGCAGTCAG
GCGTATTGGATACACGAGGTTCGCCTCATGAGCGAGGTCATGGAGGAGAGAGACGTCGTCGAGGGCGTCAACGAT
GCCCTGAGCAGCCGCATTGATATGCAGGCTGTGCTCAGGGACGCCGACGCTTACTCCCAAGCTGTCCTGCAACCG
CTGCAGAACCTGGCGCCCGACGATGCATCGTAA
Gene >Ophio5|6312
ATGGCCATCCCCTGGGACTCGTGAGACCCTCCCCCTCCCACGAAACGTGCCGTCCGTTGGCAACTAACCTTTTCA
ATCCCACAGAATCCTGTCTATAGCCTTCATTATCGGCCCCATTGCCTTGGGGAAAGCCGTGACGTCGTATCGCTC
CGCCCGCAACGTCTCGCGACCGCCGAAATCCGCCGTACGGCCCGTTCCGCTTCGCATCTGGCCCGCGCTCGGGCT
GCTATTCCTCGTGGCCGCTTTTTATCTTGTGCAGACGCTGCCTGCGCTGGCGCCGGAGAATATCTTTGTTCGTAC
GCAGAGTAGGCTGCTTACTCCTGCCGATGTCCTCTTCAACCGACTCGCGTCTTTACGGCCTGATCATGCGTTGAC
GCCCCACGATGAGGCTTTACGCGCAAGGCTCGTCAATATCGAGAGTAGGCTCCTCTACTTTCAATTTGGACCCCA
AGTTCTTGGAGACTGTCCGTTTTGCAACTCTGACGAGCCCGTCTTCTACTTTTACTACGCCCTGGTTGATCTGCT
GCGTCCACACTTCCTTAACCTCGTCATCATAGCCCTCGTTACAGCCTCCACCTGGACCGACGTCCACGGCTCGCA
GTGGCGCACCATCGCCACCCTAGCCGCGGCCTTTCTCGCTGCTGCCGATGTATTCATGGTCAAAACCTACGACTA
CAAGTCCAATACCGCCTCCTTGCGGCTCGAAGACATCGACTTTTTCTTCTGGTCCATGCGATCATATCGCCTGTT
CGCCCTCGCCGCCTTTGACGCTCTACTAGGCTATCTCATCTACCTGTCCTGCACAAACCGAGCATTCGCGACGCC
GATTTCCGCCCCGGAGCGCGTCGACGCCCTCGCCCGCGGCCTCTTGTCTGTCAAAAGCAAGATGAGCGCCATGGG
CATCGTCAGGAACACGGCTTTGCGTGACACGGATCTGCGGTCGCGCAGTCAGGCGTATTGGATACACGAGGTTCG
CCTCATGAGCGAGGTCATGGAGGAGAGAGACGTCGTCGAGGGCGTCAACGATGCCCTGAGCAGCCGCATTGATAT
GCAGGCTGTGCTCAGGGACGCCGACGCTTACTCCCAAGCTGTCCTGCAACCGCTGCAGAACCTGGCGCCCGACGA
TGCATCGTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail