Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|6311
Gene name
Locationscaffold_546:1728..3018
Strand+
Gene length (bp)1290
Transcript length (bp)1290
Coding sequence length (bp)1287
Protein length (aa) 429

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF14388 DUF4419 Domain of unknown function (DUF4419) 6.9E-93 93 392

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q5UQ60|YL662_MIMIV Uncharacterized protein L662 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_L662 PE=4 SV=1 101 309 2.0E-15

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 20 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
SC16a Pure fungal culture 707.52 264.23 1150.82
CcL In ants, during behavior modification 307.62 78.87 536.37
CcD In ants, recently dead 802.27 205.46 1399.09

Differential expression

Label1 Label2 Q-value Significant difference
SC16a CcL 0.011654 yes
SC16a CcD 0.757871 no
CcL CcD 0.007475 yes

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|6311
MRNTLLLALSGGLLSLTAAQGQEGITIWIDEDVPILPLQTDHVVHSAEELFNQSCPEEVSRYNSYHPQLLRTSYD
TVHNASFENGEVFFSSSSFIRGAVEAWGQHQHLFLRPDEVWFEILTQLNAYMFKNAEKVRDIFVNHQGQENIRVA
VWNDESAVDNLVTGFAYELRHRVKTPWLADWVKPGFSTTTPEDELTANVLMMGLLQQFFSYTGVLLCGLPSVTLL
GTREDWEALSGKLEHLKDFGEEPTQYAEVLRPIMDGFLRSWDEPDSETTKDFWSKIVLGGKNYLCSGQTLVSGWI
TGFSFWNKSGNLILTAAQRQNAERGTQLGNVKYVSRDVNLLPVSYAKVPVRMAKHPRLPPDSDVYLLAGNIGVHR
TASPEGVFAEPLSGWYMYGPVDTQFEIRENSGNGEELRGISRSIDQCSLPALAS
Coding >Ophio5|6311
ATGCGCAACACGCTTCTGCTTGCCCTCTCCGGGGGGCTTCTCTCCCTCACCGCGGCCCAAGGCCAAGAGGGTATC
ACCATCTGGATTGATGAGGACGTACCCATCCTTCCGCTCCAGACAGACCACGTCGTTCATTCTGCCGAGGAGCTT
TTCAACCAGAGTTGCCCCGAAGAAGTGTCTCGCTACAACTCCTACCACCCTCAGCTGCTCAGAACGTCTTATGAT
ACCGTCCACAACGCCTCATTCGAAAACGGCGAGGTTTTCTTCTCCTCGTCTAGCTTCATTCGCGGCGCTGTTGAG
GCCTGGGGTCAGCATCAGCACTTATTCTTGCGTCCCGACGAGGTCTGGTTCGAGATCCTGACCCAGTTGAACGCC
TACATGTTCAAAAACGCCGAAAAGGTTCGCGACATCTTTGTCAACCATCAGGGCCAGGAAAACATACGCGTCGCC
GTCTGGAACGATGAGTCGGCTGTCGATAATTTGGTTACCGGCTTCGCCTACGAACTCCGACACAGAGTCAAGACG
CCATGGCTCGCCGATTGGGTCAAGCCTGGCTTCAGTACCACCACTCCCGAGGACGAACTCACTGCCAATGTGCTC
ATGATGGGTCTCTTGCAACAGTTTTTCAGTTACACTGGCGTCCTACTCTGCGGCCTTCCGTCTGTCACCCTGCTC
GGCACCAGGGAGGATTGGGAGGCCCTGTCGGGCAAGCTGGAGCATCTCAAGGATTTTGGTGAAGAGCCGACGCAA
TATGCCGAGGTGCTGCGGCCCATCATGGACGGTTTCCTTCGCTCTTGGGACGAGCCGGACTCCGAGACTACCAAG
GATTTCTGGTCAAAGATCGTTCTTGGCGGCAAAAACTATCTTTGTAGCGGACAGACTTTGGTGTCCGGCTGGATC
ACCGGCTTTTCCTTCTGGAACAAATCGGGCAACCTCATCTTGACCGCGGCCCAGCGCCAAAATGCGGAACGCGGA
ACACAGCTCGGCAATGTCAAGTATGTCTCTCGGGACGTCAATCTGCTACCCGTCAGCTATGCCAAGGTTCCCGTC
CGTATGGCTAAACATCCGAGGCTACCTCCGGACTCGGATGTTTACCTACTGGCCGGCAATATTGGCGTTCACAGG
ACCGCGAGCCCCGAAGGCGTCTTTGCAGAACCACTCAGCGGCTGGTACATGTATGGCCCCGTGGATACTCAGTTT
GAGATCAGGGAGAATTCTGGGAATGGCGAAGAGCTTCGTGGTATATCGAGAAGCATCGACCAGTGTTCACTGCCT
GCACTCGCATCG
Transcript >Ophio5|6311
ATGCGCAACACGCTTCTGCTTGCCCTCTCCGGGGGGCTTCTCTCCCTCACCGCGGCCCAAGGCCAAGAGGGTATC
ACCATCTGGATTGATGAGGACGTACCCATCCTTCCGCTCCAGACAGACCACGTCGTTCATTCTGCCGAGGAGCTT
TTCAACCAGAGTTGCCCCGAAGAAGTGTCTCGCTACAACTCCTACCACCCTCAGCTGCTCAGAACGTCTTATGAT
ACCGTCCACAACGCCTCATTCGAAAACGGCGAGGTTTTCTTCTCCTCGTCTAGCTTCATTCGCGGCGCTGTTGAG
GCCTGGGGTCAGCATCAGCACTTATTCTTGCGTCCCGACGAGGTCTGGTTCGAGATCCTGACCCAGTTGAACGCC
TACATGTTCAAAAACGCCGAAAAGGTTCGCGACATCTTTGTCAACCATCAGGGCCAGGAAAACATACGCGTCGCC
GTCTGGAACGATGAGTCGGCTGTCGATAATTTGGTTACCGGCTTCGCCTACGAACTCCGACACAGAGTCAAGACG
CCATGGCTCGCCGATTGGGTCAAGCCTGGCTTCAGTACCACCACTCCCGAGGACGAACTCACTGCCAATGTGCTC
ATGATGGGTCTCTTGCAACAGTTTTTCAGTTACACTGGCGTCCTACTCTGCGGCCTTCCGTCTGTCACCCTGCTC
GGCACCAGGGAGGATTGGGAGGCCCTGTCGGGCAAGCTGGAGCATCTCAAGGATTTTGGTGAAGAGCCGACGCAA
TATGCCGAGGTGCTGCGGCCCATCATGGACGGTTTCCTTCGCTCTTGGGACGAGCCGGACTCCGAGACTACCAAG
GATTTCTGGTCAAAGATCGTTCTTGGCGGCAAAAACTATCTTTGTAGCGGACAGACTTTGGTGTCCGGCTGGATC
ACCGGCTTTTCCTTCTGGAACAAATCGGGCAACCTCATCTTGACCGCGGCCCAGCGCCAAAATGCGGAACGCGGA
ACACAGCTCGGCAATGTCAAGTATGTCTCTCGGGACGTCAATCTGCTACCCGTCAGCTATGCCAAGGTTCCCGTC
CGTATGGCTAAACATCCGAGGCTACCTCCGGACTCGGATGTTTACCTACTGGCCGGCAATATTGGCGTTCACAGG
ACCGCGAGCCCCGAAGGCGTCTTTGCAGAACCACTCAGCGGCTGGTACATGTATGGCCCCGTGGATACTCAGTTT
GAGATCAGGGAGAATTCTGGGAATGGCGAAGAGCTTCGTGGTATATCGAGAAGCATCGACCAGTGTTCACTGCCT
GCACTCGCATCGTAG
Gene >Ophio5|6311
ATGCGCAACACGCTTCTGCTTGCCCTCTCCGGGGGGCTTCTCTCCCTCACCGCGGCCCAAGGCCAAGAGGGTATC
ACCATCTGGATTGATGAGGACGTACCCATCCTTCCGCTCCAGACAGACCACGTCGTTCATTCTGCCGAGGAGCTT
TTCAACCAGAGTTGCCCCGAAGAAGTGTCTCGCTACAACTCCTACCACCCTCAGCTGCTCAGAACGTCTTATGAT
ACCGTCCACAACGCCTCATTCGAAAACGGCGAGGTTTTCTTCTCCTCGTCTAGCTTCATTCGCGGCGCTGTTGAG
GCCTGGGGTCAGCATCAGCACTTATTCTTGCGTCCCGACGAGGTCTGGTTCGAGATCCTGACCCAGTTGAACGCC
TACATGTTCAAAAACGCCGAAAAGGTTCGCGACATCTTTGTCAACCATCAGGGCCAGGAAAACATACGCGTCGCC
GTCTGGAACGATGAGTCGGCTGTCGATAATTTGGTTACCGGCTTCGCCTACGAACTCCGACACAGAGTCAAGACG
CCATGGCTCGCCGATTGGGTCAAGCCTGGCTTCAGTACCACCACTCCCGAGGACGAACTCACTGCCAATGTGCTC
ATGATGGGTCTCTTGCAACAGTTTTTCAGTTACACTGGCGTCCTACTCTGCGGCCTTCCGTCTGTCACCCTGCTC
GGCACCAGGGAGGATTGGGAGGCCCTGTCGGGCAAGCTGGAGCATCTCAAGGATTTTGGTGAAGAGCCGACGCAA
TATGCCGAGGTGCTGCGGCCCATCATGGACGGTTTCCTTCGCTCTTGGGACGAGCCGGACTCCGAGACTACCAAG
GATTTCTGGTCAAAGATCGTTCTTGGCGGCAAAAACTATCTTTGTAGCGGACAGACTTTGGTGTCCGGCTGGATC
ACCGGCTTTTCCTTCTGGAACAAATCGGGCAACCTCATCTTGACCGCGGCCCAGCGCCAAAATGCGGAACGCGGA
ACACAGCTCGGCAATGTCAAGTATGTCTCTCGGGACGTCAATCTGCTACCCGTCAGCTATGCCAAGGTTCCCGTC
CGTATGGCTAAACATCCGAGGCTACCTCCGGACTCGGATGTTTACCTACTGGCCGGCAATATTGGCGTTCACAGG
ACCGCGAGCCCCGAAGGCGTCTTTGCAGAACCACTCAGCGGCTGGTACATGTATGGCCCCGTGGATACTCAGTTT
GAGATCAGGGAGAATTCTGGGAATGGCGAAGAGCTTCGTGGTATATCGAGAAGCATCGACCAGTGTTCACTGCCT
GCACTCGCATCGTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail