Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|6300
Gene name
Locationscaffold_544:4714..5620
Strand+
Gene length (bp)906
Transcript length (bp)813
Coding sequence length (bp)810
Protein length (aa) 270

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF02798 GST_N Glutathione S-transferase, N-terminal domain 1.0E-08 18 90
PF13417 GST_N_3 Glutathione S-transferase, N-terminal domain 5.9E-06 20 93

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|P40582|GST1_YEAST Glutathione S-transferase 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GTT1 PE=1 SV=1 12 266 2.0E-27
sp|Q9P6M1|GST3_SCHPO Glutathione S-transferase 3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=gst3 PE=1 SV=3 14 229 4.0E-19

GO

GO Term Description Terminal node
GO:0006749 glutathione metabolic process Yes
GO:0005515 protein binding Yes
GO:0043603 cellular amide metabolic process No
GO:0009987 cellular process No
GO:0005488 binding No
GO:0006790 sulfur compound metabolic process No
GO:0006518 peptide metabolic process No
GO:0071704 organic substance metabolic process No
GO:0034641 cellular nitrogen compound metabolic process No
GO:0006807 nitrogen compound metabolic process No
GO:0003674 molecular_function No
GO:1901564 organonitrogen compound metabolic process No
GO:0008152 metabolic process No
GO:0006575 cellular modified amino acid metabolic process No
GO:0044237 cellular metabolic process No
GO:0008150 biological_process No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm Peroxisomal targeting signal 0.4914 0.3573 0.0187 0.0733 0.2064 0.0123 0.0765 0.3956 0.2737 0.3423

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup6026
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|237
Ophiocordyceps australis map64 (Brazil) OphauB2|750
Ophiocordyceps kimflemingae Ophio5|6300 (this protein)
Ophiocordyceps subramaniannii Hirsu2|1166

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|6300
MGGETGNTAAPPEIKLYWLDRSRSQRIVWLLEELQTPYEIIISHRDKQLKAPPSHARIHSLGKFPVVRITPPDGG
EPVTLAESGFITQYLCEHLPTGARLVPTRWRPGREGTVGGETKEWLRYEYLMHYVEGSLMPMLVLFLVLEGFRSK
KLPIVIRSVTSRAAGTVMKRWIKPDATKHLTMLEGILAENEEHGWVFLCGPTVSAADILISFPLISAKAHWNNMG
GWRGGSWVNEFPRVAAYTELLEKEDGYQRSVDKIKSMDGGFSASL
Coding >Ophio5|6300
ATGGGCGGCGAAACGGGCAACACGGCGGCACCTCCCGAGATCAAGCTCTACTGGCTCGACCGCTCCCGCTCACAG
CGCATTGTCTGGCTCCTCGAGGAGCTCCAGACGCCGTACGAGATCATCATCTCGCACCGCGACAAACAACTCAAG
GCGCCCCCATCTCACGCGCGGATCCACTCGCTCGGAAAGTTCCCAGTTGTGCGCATCACGCCCCCGGACGGAGGC
GAGCCCGTTACCCTAGCCGAGAGCGGCTTCATCACGCAGTATCTATGCGAGCACCTGCCCACCGGCGCACGACTG
GTCCCTACCAGGTGGCGGCCGGGGAGGGAGGGGACGGTGGGGGGAGAGACCAAGGAGTGGCTTCGCTATGAATAC
CTGATGCATTACGTCGAGGGGAGTCTGATGCCGATGCTGGTCCTGTTTCTCGTCCTCGAGGGCTTCAGGTCCAAG
AAGCTACCGATCGTGATAAGGAGCGTGACGAGCCGGGCGGCCGGGACGGTGATGAAGCGATGGATCAAACCCGAC
GCGACCAAGCACCTAACGATGCTGGAGGGGATCCTGGCCGAGAACGAGGAACACGGATGGGTCTTCCTCTGCGGT
CCGACAGTCTCGGCTGCCGACATTCTCATCAGCTTCCCGCTCATCTCGGCCAAGGCCCATTGGAACAACATGGGT
GGCTGGCGGGGGGGGTCGTGGGTGAATGAGTTTCCGCGCGTGGCGGCGTATACCGAGTTGCTGGAGAAGGAGGAC
GGCTATCAGCGGAGCGTGGACAAGATTAAGTCTATGGATGGCGGCTTTAGCGCTTCGCTA
Transcript >Ophio5|6300
ATGGGCGGCGAAACGGGCAACACGGCGGCACCTCCCGAGATCAAGCTCTACTGGCTCGACCGCTCCCGCTCACAG
CGCATTGTCTGGCTCCTCGAGGAGCTCCAGACGCCGTACGAGATCATCATCTCGCACCGCGACAAACAACTCAAG
GCGCCCCCATCTCACGCGCGGATCCACTCGCTCGGAAAGTTCCCAGTTGTGCGCATCACGCCCCCGGACGGAGGC
GAGCCCGTTACCCTAGCCGAGAGCGGCTTCATCACGCAGTATCTATGCGAGCACCTGCCCACCGGCGCACGACTG
GTCCCTACCAGGTGGCGGCCGGGGAGGGAGGGGACGGTGGGGGGAGAGACCAAGGAGTGGCTTCGCTATGAATAC
CTGATGCATTACGTCGAGGGGAGTCTGATGCCGATGCTGGTCCTGTTTCTCGTCCTCGAGGGCTTCAGGTCCAAG
AAGCTACCGATCGTGATAAGGAGCGTGACGAGCCGGGCGGCCGGGACGGTGATGAAGCGATGGATCAAACCCGAC
GCGACCAAGCACCTAACGATGCTGGAGGGGATCCTGGCCGAGAACGAGGAACACGGATGGGTCTTCCTCTGCGGT
CCGACAGTCTCGGCTGCCGACATTCTCATCAGCTTCCCGCTCATCTCGGCCAAGGCCCATTGGAACAACATGGGT
GGCTGGCGGGGGGGGTCGTGGGTGAATGAGTTTCCGCGCGTGGCGGCGTATACCGAGTTGCTGGAGAAGGAGGAC
GGCTATCAGCGGAGCGTGGACAAGATTAAGTCTATGGATGGCGGCTTTAGCGCTTCGCTATGA
Gene >Ophio5|6300
ATGGGCGGCGAAACGGGCAACACGGCGGCACCTCCCGAGATCAAGCTCTACTGGTGCGCGCCCACAGACTCAGAG
TGAAGGGCGGAGAGACGGAGAAAGGGAGAGGAAGAGAGAGCCCCGGTGGTACTGACGTCTCACACCTTAAGGCTC
GACCGCTCCCGCTCACAGCGCATTGTCTGGCTCCTCGAGGAGCTCCAGACGCCGTACGAGATCATCATCTCGCAC
CGCGACAAACAACTCAAGGCGCCCCCATCTCACGCGCGGATCCACTCGCTCGGAAAGTTCCCAGTTGTGCGCATC
ACGCCCCCGGACGGAGGCGAGCCCGTTACCCTAGCCGAGAGCGGCTTCATCACGCAGTATCTATGCGAGCACCTG
CCCACCGGCGCACGACTGGTCCCTACCAGGTGGCGGCCGGGGAGGGAGGGGACGGTGGGGGGAGAGACCAAGGAG
TGGCTTCGCTATGAATACCTGATGCATTACGTCGAGGGGAGTCTGATGCCGATGCTGGTCCTGTTTCTCGTCCTC
GAGGGCTTCAGGTCCAAGAAGCTACCGATCGTGATAAGGAGCGTGACGAGCCGGGCGGCCGGGACGGTGATGAAG
CGATGGATCAAACCCGACGCGACCAAGCACCTAACGATGCTGGAGGGGATCCTGGCCGAGAACGAGGAACACGGA
TGGGTCTTCCTCTGCGGTCCGACAGTCTCGGCTGCCGACATTCTCATCAGCTTCCCGCTCATCTCGGCCAAGGCC
CATTGGAACAACATGGGTGGCTGGCGGGGGGGGTCGTGGGTGAATGAGTTTCCGCGCGTGGCGGCGTATACCGAG
TTGCTGGAGAAGGAGGACGGCTATCAGCGGAGCGTGGACAAGATTAAGTCTATGGATGGCGGCTTTAGCGCTTCG
CTATGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail