Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|6299
Gene name
Locationscaffold_544:549..3983
Strand+
Gene length (bp)3434
Transcript length (bp)2964
Coding sequence length (bp)2961
Protein length (aa) 987

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF10537 WAC_Acf1_DNA_bd ATP-utilising chromatin assembly and remodelling N-terminal 4.1E-38 23 123
PF15613 WSD Williams-Beuren syndrome DDT (WSD), D-TOX E motif 1.2E-15 754 879
PF02791 DDT DDT domain 1.4E-15 372 429

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P53125|ITC1_YEAST Imitation switch two complex protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ITC1 PE=1 SV=1 1 404 8.0E-30
sp|P53125|ITC1_YEAST Imitation switch two complex protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ITC1 PE=1 SV=1 514 849 2.0E-10
sp|Q08964|YP216_YEAST Putative ISWI chromatin-remodeling complex subunit YPL216W OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YPL216W PE=1 SV=1 1 228 1.0E-09
sp|O88379|BAZ1A_MOUSE Bromodomain adjacent to zinc finger domain protein 1A OS=Mus musculus GN=Baz1a PE=1 SV=3 1 220 8.0E-09
sp|Q9NRL2|BAZ1A_HUMAN Bromodomain adjacent to zinc finger domain protein 1A OS=Homo sapiens GN=BAZ1A PE=1 SV=2 1 134 1.0E-08
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P53125|ITC1_YEAST Imitation switch two complex protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ITC1 PE=1 SV=1 1 404 8.0E-30
sp|P53125|ITC1_YEAST Imitation switch two complex protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ITC1 PE=1 SV=1 514 849 2.0E-10
sp|Q08964|YP216_YEAST Putative ISWI chromatin-remodeling complex subunit YPL216W OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YPL216W PE=1 SV=1 1 228 1.0E-09
sp|O88379|BAZ1A_MOUSE Bromodomain adjacent to zinc finger domain protein 1A OS=Mus musculus GN=Baz1a PE=1 SV=3 1 220 8.0E-09
sp|Q9NRL2|BAZ1A_HUMAN Bromodomain adjacent to zinc finger domain protein 1A OS=Homo sapiens GN=BAZ1A PE=1 SV=2 1 134 1.0E-08
sp|Q54ST3|Y2237_DICDI DDT domain-containing protein DDB_G0282237 OS=Dictyostelium discoideum GN=DDB_G0282237 PE=3 SV=1 23 124 1.0E-06
sp|A8DZJ1|BAZ1B_XENLA Tyrosine-protein kinase BAZ1B OS=Xenopus laevis GN=baz1b PE=2 SV=2 3 123 4.0E-06
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 58 0.45

Transmembrane Domains

(None)

Transcription Factor Class

Transcription Factor Class
(based on PFAM domains)
DDT

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|6299
MVLFKRKPVKFLSPPDIDDDAAEVWHIPQTGEIFVTYEDYLSRMEFYKQRRFNDQITGHSGLTFFEAFNSELTGG
REVDANFPEALKGPILRKVQFQTISRLDNLVDMIYDEFKHDFYPGEEVTVTMDGGDRVHGLVRDKTSFGPRMLSD
GSQAQPITRYLVNIKDTEEETMVTDEHICRDRGVFTKSMLRSFIKKTVIREAWTGAPWLVKHDYAALYHIDTRVP
PQLRYDTKVQERRQLQAQKRATPHDVNGHGAAAAAAIHQGPVRLPELKPAPKSHKGKQGTQGAKGLKWPLNMSVN
GANGYGHHHAGLRDVPSPLSPPPPPPPKYPIDDLLLEPKEGSTRPRLNFMCKNPPVDVEGRGPMCDRIDMASVGA
LLETWDTLNVYCEIFRLDSFTFDDFVEAMSVASDRVHVQLFEEIHCAVLKILVESESEGGRVCIALPELGDDDAD
EDAAAGPESPEPTPEPEPKPAGRATRSSLAKLEAERLAAEAAAAEEENLRAELASRHRAEELLKEYDWIEHLRKR
DFAHGGWQRIIVGLLHQLSKKERQEKACEELLLQLVPPNTNPTQEAVRQTYARLDVNYRAVRGYMDDCSEAMTKY
RKDRIEWQRQRKQAMEDLRQLNEERKALRPDVAPPDDHHHDVKEEDVKMADADKSLMDREGDADGKGKAHRKRRG
RGQTEKQRKADEERERKARDKDKGRDGKGHKGPTKLPPQQMKQYNKLLKEIQKREDIIKECESEIGVIENDLREA
DCARTRVLGKDRFWNRYYWFERNGMPYGGLPNSSTAFADYANGCIWVQGPDELERTGYIDVPAELQNEYRARFDM
TIPERKAREEDGTSVFNAAQWGYICEPEDVDRLIRWLDPRGLNELKLRKELLNYRDKMATHMERRQKYLSEAEAE
TAATGAEPGQVKERRDEAAKRTSSRFRDKTPETRHYRCLRWENTMALELLGHLHAEQPPPPRPKKQTRKREAAGE
AAGRGPAKTRRR
Coding >Ophio5|6299
ATGGTCCTCTTTAAGCGGAAACCCGTCAAGTTTCTGTCGCCGCCTGACATTGACGATGACGCCGCAGAGGTCTGG
CACATCCCTCAGACGGGCGAGATTTTCGTCACCTACGAAGACTATCTGAGTCGCATGGAATTCTACAAACAGCGC
CGCTTCAACGATCAGATTACGGGCCACTCGGGTCTTACCTTTTTTGAGGCCTTCAACAGCGAGCTTACCGGTGGC
CGCGAGGTCGATGCCAACTTCCCCGAGGCCCTCAAAGGGCCAATCCTGCGCAAGGTCCAGTTTCAGACCATCTCC
CGCCTCGACAACCTCGTCGACATGATTTACGACGAGTTCAAACACGACTTCTACCCCGGCGAGGAGGTTACCGTC
ACCATGGACGGCGGCGACCGCGTGCACGGCCTGGTCCGTGATAAGACGTCGTTTGGGCCTCGAATGCTGTCCGAC
GGCTCCCAGGCGCAGCCCATCACCCGATATCTCGTCAACATCAAGGACACCGAAGAGGAGACCATGGTCACCGAC
GAGCACATCTGCCGCGACCGCGGCGTCTTCACAAAGTCCATGCTGAGGTCCTTTATCAAGAAGACGGTCATTAGG
GAGGCCTGGACCGGCGCCCCATGGCTCGTCAAGCACGACTACGCCGCCTTGTACCACATCGACACTCGAGTGCCC
CCCCAGCTCCGCTACGACACAAAGGTTCAGGAGCGCCGACAGCTCCAGGCCCAGAAGCGCGCGACCCCCCACGAC
GTAAACGGCCACGGCGCCGCCGCCGCCGCCGCCATACACCAGGGCCCCGTCCGCCTGCCCGAGCTCAAGCCCGCA
CCCAAGAGCCACAAGGGCAAGCAGGGCACGCAGGGCGCAAAGGGCCTCAAGTGGCCCCTCAACATGTCCGTCAAC
GGCGCCAACGGATACGGCCACCACCACGCCGGCCTGAGAGATGTCCCCTCGCCGCTGTCTCCGCCGCCTCCGCCG
CCTCCCAAGTACCCGATCGACGACCTCCTGCTCGAGCCCAAGGAGGGCAGCACGCGTCCTCGGCTCAACTTCATG
TGCAAGAACCCCCCGGTCGACGTCGAGGGCCGCGGGCCCATGTGCGACCGCATCGACATGGCCTCCGTCGGCGCC
CTGCTGGAGACGTGGGACACGCTCAACGTCTACTGCGAGATCTTCCGGCTCGACTCGTTTACCTTTGACGACTTC
GTCGAGGCCATGTCCGTCGCCTCGGACCGCGTCCACGTCCAGCTTTTCGAGGAGATACACTGTGCCGTCCTCAAG
ATCTTGGTCGAGTCCGAGTCCGAAGGCGGCAGGGTGTGCATTGCCCTGCCCGAGCTGGGCGACGACGACGCCGAC
GAAGACGCAGCCGCCGGGCCCGAGAGCCCCGAGCCTACCCCCGAGCCCGAGCCGAAGCCTGCAGGGCGCGCCACC
CGCAGCAGCCTCGCTAAGCTCGAGGCGGAGCGGCTGGCAGCCGAGGCGGCCGCGGCCGAGGAGGAGAACCTCCGG
GCCGAGCTCGCGTCCAGGCACCGGGCCGAGGAGCTCCTCAAGGAGTACGACTGGATCGAGCACCTGCGCAAACGC
GACTTCGCCCACGGCGGCTGGCAGAGGATCATCGTCGGCCTCCTGCACCAGCTGTCGAAAAAGGAGCGACAGGAG
AAGGCGTGCGAGGAGCTGCTGCTACAGCTGGTGCCGCCCAACACGAATCCGACGCAGGAGGCGGTGCGGCAGACG
TACGCCAGGCTCGACGTCAACTACCGCGCCGTCAGGGGCTACATGGACGACTGCAGCGAGGCCATGACCAAGTAT
CGCAAGGACAGGATCGAGTGGCAGAGGCAGCGGAAGCAGGCGATGGAGGATCTCCGACAGCTCAACGAGGAGCGA
AAGGCGTTGAGGCCCGACGTGGCGCCACCCGACGACCACCACCACGACGTAAAGGAAGAGGACGTCAAGATGGCC
GACGCGGACAAGTCTCTCATGGACAGGGAGGGAGATGCAGACGGCAAGGGCAAGGCGCACAGGAAACGTCGAGGC
CGCGGTCAGACGGAGAAGCAGCGCAAGGCCGACGAGGAGAGGGAGCGAAAGGCGCGAGACAAGGACAAGGGGCGA
GACGGCAAGGGCCACAAGGGGCCGACCAAGCTGCCGCCGCAGCAGATGAAGCAGTACAACAAGCTGCTCAAGGAG
ATACAGAAGCGCGAAGACATCATCAAGGAGTGCGAGAGCGAAATCGGCGTCATCGAAAACGACCTGCGCGAGGCC
GACTGCGCCAGGACGCGTGTCTTGGGCAAGGATCGATTCTGGAACCGGTACTACTGGTTCGAACGCAACGGCATG
CCCTACGGCGGGCTACCCAACAGCTCGACGGCCTTTGCCGACTACGCCAACGGCTGCATCTGGGTGCAGGGGCCG
GACGAGCTGGAGCGGACGGGCTACATCGACGTACCGGCCGAGCTGCAGAACGAGTACCGGGCCCGATTCGATATG
ACGATCCCGGAGCGAAAAGCGCGCGAGGAGGATGGGACAAGCGTGTTCAACGCGGCGCAATGGGGCTACATCTGC
GAGCCCGAGGACGTGGACCGGCTGATCCGCTGGTTAGACCCGCGGGGCCTCAACGAGCTGAAGCTGCGCAAGGAG
CTTCTCAACTACCGCGACAAGATGGCGACGCACATGGAGCGACGTCAGAAGTATCTGTCGGAAGCGGAGGCAGAG
ACGGCAGCGACGGGAGCGGAGCCGGGCCAGGTCAAGGAGCGGCGGGACGAGGCGGCGAAGCGGACCAGTTCGCGG
TTTCGAGACAAGACGCCGGAGACGCGCCACTACCGCTGTCTGCGGTGGGAGAACACGATGGCGCTCGAGCTGCTA
GGTCACCTGCACGCGGAGCAGCCGCCACCACCGCGGCCCAAGAAGCAGACGAGGAAGAGGGAGGCGGCCGGCGAG
GCGGCCGGGCGAGGGCCGGCCAAGACTCGGCGGCGA
Transcript >Ophio5|6299
ATGGTCCTCTTTAAGCGGAAACCCGTCAAGTTTCTGTCGCCGCCTGACATTGACGATGACGCCGCAGAGGTCTGG
CACATCCCTCAGACGGGCGAGATTTTCGTCACCTACGAAGACTATCTGAGTCGCATGGAATTCTACAAACAGCGC
CGCTTCAACGATCAGATTACGGGCCACTCGGGTCTTACCTTTTTTGAGGCCTTCAACAGCGAGCTTACCGGTGGC
CGCGAGGTCGATGCCAACTTCCCCGAGGCCCTCAAAGGGCCAATCCTGCGCAAGGTCCAGTTTCAGACCATCTCC
CGCCTCGACAACCTCGTCGACATGATTTACGACGAGTTCAAACACGACTTCTACCCCGGCGAGGAGGTTACCGTC
ACCATGGACGGCGGCGACCGCGTGCACGGCCTGGTCCGTGATAAGACGTCGTTTGGGCCTCGAATGCTGTCCGAC
GGCTCCCAGGCGCAGCCCATCACCCGATATCTCGTCAACATCAAGGACACCGAAGAGGAGACCATGGTCACCGAC
GAGCACATCTGCCGCGACCGCGGCGTCTTCACAAAGTCCATGCTGAGGTCCTTTATCAAGAAGACGGTCATTAGG
GAGGCCTGGACCGGCGCCCCATGGCTCGTCAAGCACGACTACGCCGCCTTGTACCACATCGACACTCGAGTGCCC
CCCCAGCTCCGCTACGACACAAAGGTTCAGGAGCGCCGACAGCTCCAGGCCCAGAAGCGCGCGACCCCCCACGAC
GTAAACGGCCACGGCGCCGCCGCCGCCGCCGCCATACACCAGGGCCCCGTCCGCCTGCCCGAGCTCAAGCCCGCA
CCCAAGAGCCACAAGGGCAAGCAGGGCACGCAGGGCGCAAAGGGCCTCAAGTGGCCCCTCAACATGTCCGTCAAC
GGCGCCAACGGATACGGCCACCACCACGCCGGCCTGAGAGATGTCCCCTCGCCGCTGTCTCCGCCGCCTCCGCCG
CCTCCCAAGTACCCGATCGACGACCTCCTGCTCGAGCCCAAGGAGGGCAGCACGCGTCCTCGGCTCAACTTCATG
TGCAAGAACCCCCCGGTCGACGTCGAGGGCCGCGGGCCCATGTGCGACCGCATCGACATGGCCTCCGTCGGCGCC
CTGCTGGAGACGTGGGACACGCTCAACGTCTACTGCGAGATCTTCCGGCTCGACTCGTTTACCTTTGACGACTTC
GTCGAGGCCATGTCCGTCGCCTCGGACCGCGTCCACGTCCAGCTTTTCGAGGAGATACACTGTGCCGTCCTCAAG
ATCTTGGTCGAGTCCGAGTCCGAAGGCGGCAGGGTGTGCATTGCCCTGCCCGAGCTGGGCGACGACGACGCCGAC
GAAGACGCAGCCGCCGGGCCCGAGAGCCCCGAGCCTACCCCCGAGCCCGAGCCGAAGCCTGCAGGGCGCGCCACC
CGCAGCAGCCTCGCTAAGCTCGAGGCGGAGCGGCTGGCAGCCGAGGCGGCCGCGGCCGAGGAGGAGAACCTCCGG
GCCGAGCTCGCGTCCAGGCACCGGGCCGAGGAGCTCCTCAAGGAGTACGACTGGATCGAGCACCTGCGCAAACGC
GACTTCGCCCACGGCGGCTGGCAGAGGATCATCGTCGGCCTCCTGCACCAGCTGTCGAAAAAGGAGCGACAGGAG
AAGGCGTGCGAGGAGCTGCTGCTACAGCTGGTGCCGCCCAACACGAATCCGACGCAGGAGGCGGTGCGGCAGACG
TACGCCAGGCTCGACGTCAACTACCGCGCCGTCAGGGGCTACATGGACGACTGCAGCGAGGCCATGACCAAGTAT
CGCAAGGACAGGATCGAGTGGCAGAGGCAGCGGAAGCAGGCGATGGAGGATCTCCGACAGCTCAACGAGGAGCGA
AAGGCGTTGAGGCCCGACGTGGCGCCACCCGACGACCACCACCACGACGTAAAGGAAGAGGACGTCAAGATGGCC
GACGCGGACAAGTCTCTCATGGACAGGGAGGGAGATGCAGACGGCAAGGGCAAGGCGCACAGGAAACGTCGAGGC
CGCGGTCAGACGGAGAAGCAGCGCAAGGCCGACGAGGAGAGGGAGCGAAAGGCGCGAGACAAGGACAAGGGGCGA
GACGGCAAGGGCCACAAGGGGCCGACCAAGCTGCCGCCGCAGCAGATGAAGCAGTACAACAAGCTGCTCAAGGAG
ATACAGAAGCGCGAAGACATCATCAAGGAGTGCGAGAGCGAAATCGGCGTCATCGAAAACGACCTGCGCGAGGCC
GACTGCGCCAGGACGCGTGTCTTGGGCAAGGATCGATTCTGGAACCGGTACTACTGGTTCGAACGCAACGGCATG
CCCTACGGCGGGCTACCCAACAGCTCGACGGCCTTTGCCGACTACGCCAACGGCTGCATCTGGGTGCAGGGGCCG
GACGAGCTGGAGCGGACGGGCTACATCGACGTACCGGCCGAGCTGCAGAACGAGTACCGGGCCCGATTCGATATG
ACGATCCCGGAGCGAAAAGCGCGCGAGGAGGATGGGACAAGCGTGTTCAACGCGGCGCAATGGGGCTACATCTGC
GAGCCCGAGGACGTGGACCGGCTGATCCGCTGGTTAGACCCGCGGGGCCTCAACGAGCTGAAGCTGCGCAAGGAG
CTTCTCAACTACCGCGACAAGATGGCGACGCACATGGAGCGACGTCAGAAGTATCTGTCGGAAGCGGAGGCAGAG
ACGGCAGCGACGGGAGCGGAGCCGGGCCAGGTCAAGGAGCGGCGGGACGAGGCGGCGAAGCGGACCAGTTCGCGG
TTTCGAGACAAGACGCCGGAGACGCGCCACTACCGCTGTCTGCGGTGGGAGAACACGATGGCGCTCGAGCTGCTA
GGTCACCTGCACGCGGAGCAGCCGCCACCACCGCGGCCCAAGAAGCAGACGAGGAAGAGGGAGGCGGCCGGCGAG
GCGGCCGGGCGAGGGCCGGCCAAGACTCGGCGGCGATGA
Gene >Ophio5|6299
ATGGTAACCGCCACAGTTTTCCTTCCCCTCTCCCCCGCCTCTCTCACTCCCCTCGCTCCCCACTCGGACCGCGCT
CACACTTGGTCTCGTTAGGTCCTCTTTAAGCGGAAACCCGTCAAGTTTCTGTCGCCGCCTGACATTGACGATGAC
GCCGCAGAGGTGACGTCTCCCCCTCCAACTGCAGCAAACCACCTCTCCTCCGCCTCGACGCGTCTACTTACTCCC
CTAAAAGGTCTGGCACATCCCTCAGACGGGCGAGATTTTCGTCACCTACGAAGACTATCTGAGTCGGTCAGCAGC
CCCGTTCCTCCCCGTCCCTGTAGCCGCCCTCAAGGCTGACCCTCTGGTCTGTGTGCAGCATGGAATTCTACAAAC
AGGTGCCCGATTCCCGCCGCGTCCCCCGGCTCCGCCCATGGCGCGACGCCGCTAATCTCTCCCCGTCTCTTGCAG
CGCCGCTTCAACGATCAGATTACGGGCCACTCGGGTCTTACCTTTTTTGAGGCCTTCAACAGCGAGGTACGCCCC
CCGTTGCATCGACCGTCCTATGCCACGCGTCGGTGGCTGTGATGCTCACTCCTCTCGTTGCGCAGCTTACCGGTG
GCCGCGAGGTCGATGCCAACTTCCCCGAGGCCCTCAAAGGGCCAATCCTGCGCAAGGTCCAGTTTCAGACCATCT
CCCGCCTCGACAACCTCGTCGACATGATTTACGACGAGTTCAAACACGACTTCTACCCCGGCGAGGAGGTTACCG
TCACCATGGACGGCGGCGACCGCGTGCACGGCCTGGTCCGTGATAAGACGTCGTTTGGGCCTCGAATGCTGTCCG
ACGGCTCCCAGGCGCAGCCCATCACCCGATATCTCGTCAACATCAAGGACACCGAAGAGGAGACCATGGTCACCG
ACGAGCACATCTGCCGCGACCGCGGCGTCTTCACAAAGTCCATGCTGAGGTCCTTTATCAAGAAGACGGTCATTA
GGGAGGCCTGGACCGGCGCCCCATGGCTCGTCAAGCACGACTACGCCGCCTTGTACCACATCGACACTCGAGTGC
CCCCCCAGCTCCGCTACGACACAAAGGTTCAGGAGCGCCGACAGCTCCAGGCCCAGAAGCGCGCGACCCCCCACG
ACGTAAACGGCCACGGCGCCGCCGCCGCCGCCGCCATACACCAGGGCCCCGTCCGCCTGCCCGAGCTCAAGCCCG
CACCCAAGAGCCACAAGGGCAAGCAGGGCACGCAGGGCGCAAAGGGCCTCAAGTGGCCCCTCAACATGTCCGTCA
ACGGCGCCAACGGATACGGCCACCACCACGCCGGCCTGAGAGATGTCCCCTCGCCGCTGTCTCCGCCGCCTCCGC
CGCCTCCCAAGTACCCGATCGACGACCTCCTGCTCGAGCCCAAGGAGGGCAGCACGCGTCCTCGGCTCAACTTCA
TGTGCAAGAACCCCCCGGTCGACGTCGAGGGCCGCGGGCCCATGTGCGACCGCATCGACATGGCCTCCGTCGGCG
CCCTGCTGGAGACGTGGGACACGCTCAACGTCTACTGCGAGATCTTCCGGCTCGACTCGTTTACCTTTGACGACT
TCGTCGAGGCCATGTCCGTCGCCTCGGACCGCGTCCACGTCCAGCTTTTCGAGGAGATACACTGTGCCGTCCTCA
AGATCTTGGTCGAGTCCGAGTCCGAAGGCGGCAGGGTGTGCATTGCCCTGCCCGAGCTGGGCGACGACGACGCCG
ACGAAGACGCAGCCGCCGGGCCCGAGAGCCCCGAGCCTACCCCCGAGCCCGAGCCGAAGCCTGCAGGGCGCGCCA
CCCGCAGCAGCCTCGCTAAGCTCGAGGCGGAGCGGCTGGCAGCCGAGGCGGCCGCGGCCGAGGAGGAGAACCTCC
GGGCCGAGCTCGCGTCCAGGCACCGGGCCGAGGAGCTCCTCAAGGAGTACGACTGGATCGAGCACCTGCGCAAAC
GCGACTTCGCCCACGGCGGCTGGCAGAGGATCATCGTCGGCCTCCTGCACCAGCTGTCGAAAAAGGAGCGACAGG
AGAAGGCGTGCGAGGAGCTGCTGCTACAGCTGGTGCCGCCCAACACGAATCCGACGCAGGAGGCGGTGCGGCAGA
CGTACGCCAGGCTCGACGTCAACTACCGCGTGCGTGCGCTGCAGATACTCTGCATGCTGACCATGGAGACCAAGG
CCGTCAGGGGCTACATGGACGACTGCAGCGAGGCCATGACCAAGTATCGCAAGGACAGGATCGAGTGGCAGAGGC
AGCGGAAGCAGGCGTATGTCTTGTCTCTCGGCTCCCCGGCTCCCCGGCTGACGCTTCCCAGGATGGAGGATCTCC
GACAGCTCAACGAGGAGCGAAAGGCGTTGAGGCCCGACGTGGCGCCACCCGACGACCACCACCACGACGTAAAGG
AAGAGGACGTCAAGATGGCCGACGCGGACAAGTCTCTCATGGACAGGGAGGGAGATGCAGACGGCAAGGGCAAGG
CGCACAGGAAACGTCGAGGCCGCGGTCAGACGGAGAAGCAGCGCAAGGCCGACGAGGAGAGGGAGCGAAAGGCGC
GAGACAAGGACAAGGGGCGAGACGGCAAGGGCCACAAGGGGCCGACCAAGCTGCCGCCGCAGCAGATGAAGCAGT
ACAACAAGCTGCTCAAGGAGATACAGAAGCGCGAAGACATCATCAAGGAGTGCGAGAGCGAAATCGGCGTCATCG
AAAACGACCTGCGCGAGGCCGACTGCGCCAGGACGCGTGTCTTGGGCAAGGATCGATTCTGGAACCGGTACTACT
GGTTCGAACGCAACGGCATGCCCTACGGCGGGCTACCCAACAGCTCGACGGCCTTTGCCGACTACGCCAACGGCT
GCATCTGGGTGCAGGGGCCGGACGAGCTGGAGCGGACGGGCTACATCGACGTACCGGCCGAGCTGCAGAACGAGT
ACCGGGCCCGATTCGATATGACGATCCCGGAGCGAAAAGCGCGCGAGGAGGATGGGACAAGCGTGTTCAACGCGG
CGCAATGGGGCTACATCTGCGAGCCCGAGGACGTGGACCGGCTGATCCGCTGGTTAGACCCGCGGGGCCTCAACG
AGCTGAAGCTGCGCAAGGAGCTTCTCAACTACCGCGACAAGATGGCGACGCACATGGAGCGACGTCAGAAGTATC
TGTCGGAAGCGGAGGCAGAGACGGCAGCGACGGGAGCGGAGCCGGGCCAGGTCAAGGAGCGGCGGGACGAGGCGG
CGAAGCGGACCAGTTCGCGGTTTCGAGACAAGACGCCGGAGACGCGCCACTACCGCTGTCTGCGGTGGGAGAACA
CGATGGCGCTCGAGCTGCTAGGTCACCTGCACGCGGAGCAGCCGCCACCACCGCGGCCCAAGAAGCAGACGAGGA
AGAGGGAGGCGGCCGGCGAGGCGGCCGGGCGAGGGCCGGCCAAGACTCGGCGGCGATGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail