Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|6296
Gene name
Locationscaffold_543:4468..6936
Strand-
Gene length (bp)2468
Transcript length (bp)2331
Coding sequence length (bp)2328
Protein length (aa) 776

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF08659 KR KR domain 1.7E-23 166 240
PF07993 NAD_binding_4 Male sterility protein 2.3E-16 480 560
PF07993 NAD_binding_4 Male sterility protein 1.2E-04 562 652
PF00550 PP-binding Phosphopantetheine attachment site 9.6E-07 344 402

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|B2HIL7|MSL7_MYCMM Phenolphthiocerol synthesis polyketide synthase type I Pks15/1 OS=Mycobacterium marinum (strain ATCC BAA-535 / M) GN=pks15/1 PE=1 SV=1 169 417 2.0E-30
sp|Q7TXK8|MSL7_MYCBO Phenolphthiocerol synthesis polyketide synthase type I Pks15/1 OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=pks15/1 PE=1 SV=1 169 417 4.0E-30
sp|P96285|PKS1_MYCTU Putative inactive phenolphthiocerol synthesis polyketide synthase type I Pks1 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=pks1 PE=1 SV=4 169 417 1.0E-29
sp|Q03131|ERYA1_SACER Erythronolide synthase, modules 1 and 2 OS=Saccharopolyspora erythraea GN=eryA PE=1 SV=1 167 414 6.0E-28
sp|Q07017|OL56_STRAT Oleandomycin polyketide synthase, modules 5 and 6 OS=Streptomyces antibioticus GN=orfB PE=3 SV=1 172 431 1.0E-25
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|B2HIL7|MSL7_MYCMM Phenolphthiocerol synthesis polyketide synthase type I Pks15/1 OS=Mycobacterium marinum (strain ATCC BAA-535 / M) GN=pks15/1 PE=1 SV=1 169 417 2.0E-30
sp|Q7TXK8|MSL7_MYCBO Phenolphthiocerol synthesis polyketide synthase type I Pks15/1 OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=pks15/1 PE=1 SV=1 169 417 4.0E-30
sp|P96285|PKS1_MYCTU Putative inactive phenolphthiocerol synthesis polyketide synthase type I Pks1 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=pks1 PE=1 SV=4 169 417 1.0E-29
sp|Q03131|ERYA1_SACER Erythronolide synthase, modules 1 and 2 OS=Saccharopolyspora erythraea GN=eryA PE=1 SV=1 167 414 6.0E-28
sp|Q07017|OL56_STRAT Oleandomycin polyketide synthase, modules 5 and 6 OS=Streptomyces antibioticus GN=orfB PE=3 SV=1 172 431 1.0E-25
sp|Q07017|OL56_STRAT Oleandomycin polyketide synthase, modules 5 and 6 OS=Streptomyces antibioticus GN=orfB PE=3 SV=1 172 401 9.0E-25
sp|P37693|HETM_NOSS1 Polyketide synthase HetM OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=hetM PE=3 SV=1 328 731 2.0E-24
sp|Q03133|ERYA3_SACER Erythronolide synthase, modules 5 and 6 OS=Saccharopolyspora erythraea GN=eryA PE=1 SV=4 172 404 3.0E-22
sp|Q03131|ERYA1_SACER Erythronolide synthase, modules 1 and 2 OS=Saccharopolyspora erythraea GN=eryA PE=1 SV=1 172 414 3.0E-21
sp|Q03132|ERYA2_SACER Erythronolide synthase, modules 3 and 4 OS=Saccharopolyspora erythraea GN=eryA PE=1 SV=3 169 403 3.0E-21
sp|Q70LM4|LGRD_BREPA Linear gramicidin synthase subunit D OS=Brevibacillus parabrevis GN=lgrD PE=1 SV=1 431 766 1.0E-20
sp|A1KQG0|PHAS_MYCBP Phthioceranic/hydroxyphthioceranic acid synthase OS=Mycobacterium bovis (strain BCG / Pasteur 1173P2) GN=pks2 PE=3 SV=1 160 392 1.0E-20
sp|Q7TVK8|PHAS_MYCBO Phthioceranic/hydroxyphthioceranic acid synthase OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=pks2 PE=3 SV=1 160 392 1.0E-20
sp|A5U9F4|PHAS_MYCTA Phthioceranic/hydroxyphthioceranic acid synthase OS=Mycobacterium tuberculosis (strain ATCC 25177 / H37Ra) GN=pks2 PE=3 SV=1 160 392 1.0E-20
sp|P9WQE8|PHAS_MYCTO Phthioceranic/hydroxyphthioceranic acid synthase OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=pks2 PE=3 SV=1 160 392 1.0E-20
sp|P9WQE9|PHAS_MYCTU Phthioceranic/hydroxyphthioceranic acid synthase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=pks2 PE=1 SV=1 160 392 1.0E-20
sp|Q03133|ERYA3_SACER Erythronolide synthase, modules 5 and 6 OS=Saccharopolyspora erythraea GN=eryA PE=1 SV=4 172 491 6.0E-20
sp|Q7TXM0|PPSA_MYCBO Phthiocerol/phenolphthiocerol synthesis polyketide synthase type I PpsA OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=ppsA PE=1 SV=1 171 410 5.0E-17
sp|P9WQE7|PPSA_MYCTU Phthiocerol synthesis polyketide synthase type I PpsA OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=ppsA PE=1 SV=1 171 410 5.0E-17
sp|P9WQE6|PPSA_MYCTO Phthiocerol synthesis polyketide synthase type I PpsA OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=ppsA PE=3 SV=1 171 410 6.0E-17
sp|Q02251|MCAS_MYCBO Mycocerosic acid synthase OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=mas PE=1 SV=2 160 410 6.0E-17
sp|Q7TXL8|PPSC_MYCBO Phthiocerol/phenolphthiocerol synthesis polyketide synthase type I PpsC OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=ppsC PE=1 SV=1 167 402 9.0E-16
sp|P96202|PPSC_MYCTU Phthiocerol synthesis polyketide synthase type I PpsC OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=ppsC PE=1 SV=2 167 402 9.0E-16
sp|Q9Y7D5|LOVF_ASPTE Lovastatin diketide synthase LovF OS=Aspergillus terreus GN=lovF PE=1 SV=1 169 392 4.0E-15
sp|B4XYB8|AZIB_STREG 5-methyl-1-naphthoate synthase OS=Streptomyces sahachiroi GN=aziB PE=1 SV=1 171 426 9.0E-15
sp|Q7TXL9|PPSB_MYCBO Phthiocerol/phenolphthiocerol synthesis polyketide synthase type I PpsB OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=ppsB PE=1 SV=1 164 443 2.0E-12
sp|P40806|PKSJ_BACSU Polyketide synthase PksJ OS=Bacillus subtilis (strain 168) GN=pksJ PE=1 SV=3 169 424 4.0E-12
sp|P40976|LYS2_SCHPO L-2-aminoadipate reductase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=lys1 PE=1 SV=3 476 653 9.0E-12
sp|P9WQE5|PPSB_MYCTU Phthiocerol synthesis polyketide synthase type I PpsB OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=ppsB PE=1 SV=1 164 443 1.0E-11
sp|P9WQE4|PPSB_MYCTO Phthiocerol synthesis polyketide synthase type I PpsB OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=ppsB PE=3 SV=1 164 443 1.0E-11
sp|Q05470|PKSL_BACSU Polyketide synthase PksL OS=Bacillus subtilis (strain 168) GN=pksL PE=1 SV=3 169 420 2.0E-11
sp|Q03132|ERYA2_SACER Erythronolide synthase, modules 3 and 4 OS=Saccharopolyspora erythraea GN=eryA PE=1 SV=3 192 402 3.0E-11
sp|Q6FMI5|LYS2_CANGA L-2-aminoadipate reductase large subunit OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=LYS2 PE=3 SV=1 466 665 4.0E-11
sp|P9WQE3|PPSD_MYCTU Phthiocerol synthesis polyketide synthase type I PpsD OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=ppsD PE=1 SV=1 171 381 8.0E-11
sp|Q7TXL7|PPSD_MYCBO Phthiocerol/phenolphthiocerol synthesis polyketide synthase type I PpsD OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=ppsD PE=3 SV=1 171 381 8.0E-11
sp|P9WQE2|PPSD_MYCTO Phthiocerol synthesis polyketide synthase type I PpsD OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=ppsD PE=3 SV=1 171 381 8.0E-11
sp|P22367|MSAS_PENPA 6-methylsalicylic acid synthase OS=Penicillium patulum PE=1 SV=1 166 414 3.0E-10
sp|Q55E72|PKS1_DICDI Probable polyketide synthase 1 OS=Dictyostelium discoideum GN=stlA PE=1 SV=1 171 377 5.0E-10
sp|Q05470|PKSL_BACSU Polyketide synthase PksL OS=Bacillus subtilis (strain 168) GN=pksL PE=1 SV=3 169 443 2.0E-09
sp|O74298|LYS2_PENCH L-2-aminoadipate reductase large subunit OS=Penicillium chrysogenum GN=lys2 PE=3 SV=1 463 653 9.0E-09
sp|A1CLY8|CCSA_ASPCL Polyketide synthase-nonribosomal peptide synthetase OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=ccsA PE=3 SV=1 169 414 2.0E-08
sp|Q75BB3|LYS2_ASHGO L-2-aminoadipate reductase large subunit OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=LYS2 PE=3 SV=2 376 714 2.0E-08
sp|Q9Y8A5|LNKS_ASPTE Lovastatin nonaketide synthase OS=Aspergillus terreus GN=lovB PE=1 SV=1 169 417 4.0E-06
sp|Q12572|LYS2_CANAX L-2-aminoadipate reductase large subunit OS=Candida albicans GN=LYS2 PE=3 SV=2 477 559 6.0E-06
sp|Q54B49|PKS45_DICDI Probable polyketide synthase 45 OS=Dictyostelium discoideum GN=pks45 PE=3 SV=2 207 559 9.0E-06
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 23 0.45

Transmembrane Domains

Domain # Start End Length
1 190 212 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|6296
MQALADLGADLFLELDPKPVLCALGATCLGEDVLRPGSDWLPSLVPDRDEVQVVVESLAALHVRDAAISWHAYFH
LAGCRRVDLPTYAFQRHLGAGGRPGQVGAVRAGGTWGLLCPAGQVPGAGELADALSRSGVRLEQVGQLGEAEGFD
GLLGLWSSSSNVIDQTRHLRPKVDGAWHLHQLTRSIDAGMFVMLFSISGVLGMPGLAIYAAANTFLDSLAHLRRS
QGLPATSLAYGTWQDDGMAAGSTRSTWAHLTQFGLNDLTPSDGLRLLERAVRSKRALTVGASLDSRRLRAYLEDR
GGIPPLFYSLLGHGGPPASRSCHLREALAVARREQRADLVIGMVRVLVAKALGFATADEISIDQPLSEIGIDSLT
AVLVRNHLAALTGLKLSANLAFLYPNILKALAGFFLSEMQDSLLDDTSSTPRTPVSTVSGANNHSMTEGSAHLDL
GAIRKGCLDSSFTFENPSHHTAARLESVFVTGATGFIGAFIVGELLQRHIHVHCLVRADSLDHGRRRIVDTLRAY
GLWAAHYDSLLRPLVRDMAQPFLGLLDDDFDHLALRLASRGRGKAVHLISTVGTVPRHVGFDVSEEDYEYNYATS
KFLAERMPAAARWRGARASAYRIPFVTASSSTGHFRLDRGDFLHNLIVESIDMFGIIVIQDPAKIGKDFDFTNTR
PLSFDDFFKLMIKAGAGRMIVPFPDWRDQALATAGASEKGPLARIAVVLDNCTDENAAAMFGAPPVGQHVLGGND
FPVPPVDDESVGKYINRIFLAQQIGT
Coding >Ophio5|6296
ATGCAAGCTCTCGCCGACCTCGGCGCCGACCTGTTTCTCGAGCTTGACCCAAAGCCGGTCCTGTGCGCCCTCGGG
GCGACGTGTCTGGGAGAAGACGTCCTGCGCCCCGGCAGCGACTGGCTGCCGTCGCTGGTTCCTGACAGAGACGAG
GTCCAAGTCGTCGTCGAAAGCCTGGCAGCGCTCCACGTCCGCGACGCGGCCATCAGCTGGCACGCCTACTTCCAT
CTCGCCGGCTGCCGAAGAGTGGACTTGCCGACGTATGCCTTCCAGCGCCACCTCGGCGCGGGGGGCCGCCCCGGC
CAAGTGGGCGCGGTGCGCGCTGGCGGCACCTGGGGCTTGCTATGTCCAGCGGGACAGGTGCCTGGGGCCGGAGAG
CTGGCTGACGCTCTGTCGCGGTCTGGGGTCCGCCTGGAGCAGGTCGGGCAGCTGGGCGAGGCAGAAGGGTTCGAC
GGGCTACTAGGTCTGTGGAGCTCAAGCTCCAACGTGATAGACCAGACGCGGCATTTGCGCCCAAAGGTCGACGGC
GCATGGCACCTCCATCAGCTCACGCGCTCCATAGACGCAGGCATGTTCGTCATGTTGTTCTCCATCTCTGGCGTC
TTAGGCATGCCAGGTCTTGCCATCTACGCCGCCGCAAACACCTTCCTCGACTCTCTCGCCCACCTACGTCGATCT
CAGGGCCTACCGGCTACCTCACTGGCGTATGGCACCTGGCAGGATGATGGCATGGCGGCCGGCTCAACGCGGTCG
ACTTGGGCTCACCTCACCCAATTCGGCCTTAACGATCTTACACCAAGCGACGGCCTACGCCTTCTTGAGCGGGCA
GTACGCAGTAAGCGTGCCCTCACCGTCGGCGCCTCGCTCGATTCTCGTCGACTTCGGGCCTATCTCGAGGACCGA
GGCGGCATTCCCCCTCTCTTCTATTCTCTCTTGGGTCACGGCGGTCCGCCTGCCAGCCGAAGCTGCCACCTTCGC
GAGGCGCTAGCTGTGGCACGCCGCGAGCAGCGCGCTGACCTTGTCATTGGCATGGTCCGGGTCTTGGTGGCCAAG
GCATTGGGCTTTGCCACTGCCGACGAGATCAGTATCGACCAACCCCTGTCGGAAATAGGTATCGACTCTTTGACG
GCTGTCCTGGTTCGCAACCATTTAGCGGCTCTCACCGGGCTCAAGCTCTCTGCGAACCTTGCCTTTCTTTATCCA
AATATTCTCAAGGCTCTGGCTGGCTTCTTCCTGTCCGAAATGCAGGACAGCCTTCTGGACGATACCTCGTCGACT
CCACGTACGCCAGTGTCCACGGTCTCGGGCGCGAATAACCACAGTATGACCGAGGGAAGCGCCCATTTAGATCTT
GGAGCCATCCGCAAGGGCTGCCTCGACTCCAGCTTCACATTTGAAAACCCTTCTCACCACACCGCCGCCCGCCTC
GAGTCCGTTTTCGTCACGGGCGCCACGGGCTTTATCGGTGCCTTCATCGTCGGAGAGCTGCTCCAGAGGCATATT
CATGTCCACTGCCTCGTGCGTGCCGACAGCCTCGACCACGGGCGACGGCGCATCGTGGACACGCTTCGCGCTTAT
GGCCTCTGGGCCGCTCACTACGACTCGCTGCTCCGCCCCTTGGTTCGTGATATGGCGCAGCCCTTCCTCGGCCTG
CTAGACGACGACTTTGATCATCTGGCCCTACGCTTAGCTTCACGTGGACGAGGGAAGGCTGTCCATCTGATTTCC
ACAGTTGGTACAGTGCCCAGGCATGTCGGCTTCGACGTATCCGAGGAAGACTATGAGTATAACTACGCCACCTCC
AAGTTTCTGGCGGAACGTATGCCGGCCGCTGCTCGTTGGCGCGGCGCAAGGGCTTCTGCGTACCGTATCCCCTTT
GTCACAGCCTCCTCCTCGACCGGCCACTTTCGACTTGACCGCGGCGACTTTCTGCATAACTTGATCGTTGAAAGT
ATCGACATGTTTGGCATAATAGTCATCCAAGACCCAGCTAAGATCGGCAAAGACTTTGACTTTACCAACACACGA
CCTCTGAGCTTCGACGATTTCTTTAAGCTGATGATCAAAGCCGGTGCTGGGCGGATGATTGTGCCGTTCCCTGAC
TGGAGGGACCAGGCCCTAGCCACGGCCGGTGCGAGTGAAAAGGGTCCGCTGGCCCGCATCGCCGTCGTCCTCGAC
AACTGTACCGACGAAAATGCGGCGGCCATGTTTGGTGCTCCGCCCGTGGGGCAGCACGTACTGGGAGGCAATGAT
TTCCCCGTGCCGCCTGTCGATGACGAGTCTGTCGGCAAGTATATAAATCGCATTTTCCTCGCTCAGCAAATCGGC
ACC
Transcript >Ophio5|6296
ATGCAAGCTCTCGCCGACCTCGGCGCCGACCTGTTTCTCGAGCTTGACCCAAAGCCGGTCCTGTGCGCCCTCGGG
GCGACGTGTCTGGGAGAAGACGTCCTGCGCCCCGGCAGCGACTGGCTGCCGTCGCTGGTTCCTGACAGAGACGAG
GTCCAAGTCGTCGTCGAAAGCCTGGCAGCGCTCCACGTCCGCGACGCGGCCATCAGCTGGCACGCCTACTTCCAT
CTCGCCGGCTGCCGAAGAGTGGACTTGCCGACGTATGCCTTCCAGCGCCACCTCGGCGCGGGGGGCCGCCCCGGC
CAAGTGGGCGCGGTGCGCGCTGGCGGCACCTGGGGCTTGCTATGTCCAGCGGGACAGGTGCCTGGGGCCGGAGAG
CTGGCTGACGCTCTGTCGCGGTCTGGGGTCCGCCTGGAGCAGGTCGGGCAGCTGGGCGAGGCAGAAGGGTTCGAC
GGGCTACTAGGTCTGTGGAGCTCAAGCTCCAACGTGATAGACCAGACGCGGCATTTGCGCCCAAAGGTCGACGGC
GCATGGCACCTCCATCAGCTCACGCGCTCCATAGACGCAGGCATGTTCGTCATGTTGTTCTCCATCTCTGGCGTC
TTAGGCATGCCAGGTCTTGCCATCTACGCCGCCGCAAACACCTTCCTCGACTCTCTCGCCCACCTACGTCGATCT
CAGGGCCTACCGGCTACCTCACTGGCGTATGGCACCTGGCAGGATGATGGCATGGCGGCCGGCTCAACGCGGTCG
ACTTGGGCTCACCTCACCCAATTCGGCCTTAACGATCTTACACCAAGCGACGGCCTACGCCTTCTTGAGCGGGCA
GTACGCAGTAAGCGTGCCCTCACCGTCGGCGCCTCGCTCGATTCTCGTCGACTTCGGGCCTATCTCGAGGACCGA
GGCGGCATTCCCCCTCTCTTCTATTCTCTCTTGGGTCACGGCGGTCCGCCTGCCAGCCGAAGCTGCCACCTTCGC
GAGGCGCTAGCTGTGGCACGCCGCGAGCAGCGCGCTGACCTTGTCATTGGCATGGTCCGGGTCTTGGTGGCCAAG
GCATTGGGCTTTGCCACTGCCGACGAGATCAGTATCGACCAACCCCTGTCGGAAATAGGTATCGACTCTTTGACG
GCTGTCCTGGTTCGCAACCATTTAGCGGCTCTCACCGGGCTCAAGCTCTCTGCGAACCTTGCCTTTCTTTATCCA
AATATTCTCAAGGCTCTGGCTGGCTTCTTCCTGTCCGAAATGCAGGACAGCCTTCTGGACGATACCTCGTCGACT
CCACGTACGCCAGTGTCCACGGTCTCGGGCGCGAATAACCACAGTATGACCGAGGGAAGCGCCCATTTAGATCTT
GGAGCCATCCGCAAGGGCTGCCTCGACTCCAGCTTCACATTTGAAAACCCTTCTCACCACACCGCCGCCCGCCTC
GAGTCCGTTTTCGTCACGGGCGCCACGGGCTTTATCGGTGCCTTCATCGTCGGAGAGCTGCTCCAGAGGCATATT
CATGTCCACTGCCTCGTGCGTGCCGACAGCCTCGACCACGGGCGACGGCGCATCGTGGACACGCTTCGCGCTTAT
GGCCTCTGGGCCGCTCACTACGACTCGCTGCTCCGCCCCTTGGTTCGTGATATGGCGCAGCCCTTCCTCGGCCTG
CTAGACGACGACTTTGATCATCTGGCCCTACGCTTAGCTTCACGTGGACGAGGGAAGGCTGTCCATCTGATTTCC
ACAGTTGGTACAGTGCCCAGGCATGTCGGCTTCGACGTATCCGAGGAAGACTATGAGTATAACTACGCCACCTCC
AAGTTTCTGGCGGAACGTATGCCGGCCGCTGCTCGTTGGCGCGGCGCAAGGGCTTCTGCGTACCGTATCCCCTTT
GTCACAGCCTCCTCCTCGACCGGCCACTTTCGACTTGACCGCGGCGACTTTCTGCATAACTTGATCGTTGAAAGT
ATCGACATGTTTGGCATAATAGTCATCCAAGACCCAGCTAAGATCGGCAAAGACTTTGACTTTACCAACACACGA
CCTCTGAGCTTCGACGATTTCTTTAAGCTGATGATCAAAGCCGGTGCTGGGCGGATGATTGTGCCGTTCCCTGAC
TGGAGGGACCAGGCCCTAGCCACGGCCGGTGCGAGTGAAAAGGGTCCGCTGGCCCGCATCGCCGTCGTCCTCGAC
AACTGTACCGACGAAAATGCGGCGGCCATGTTTGGTGCTCCGCCCGTGGGGCAGCACGTACTGGGAGGCAATGAT
TTCCCCGTGCCGCCTGTCGATGACGAGTCTGTCGGCAAGTATATAAATCGCATTTTCCTCGCTCAGCAAATCGGC
ACCTAA
Gene >Ophio5|6296
ATGCAAGCTCTCGCCGACCTCGGCGCCGACCTGTTTCTCGAGCTTGACCCAAAGCCGGTCCTGTGCGCCCTCGGG
GCGACGTGTCTGGGAGAAGACGTCCTGCGCCCCGGCAGCGACTGGCTGCCGTCGCTGGTTCCTGACAGAGACGAG
GTCCAAGTCGTCGTCGAAAGCCTGGCAGCGCTCCACGTCCGCGACGCGGCCATCAGCTGGCACGCCTACTTCCAT
CTCGCCGGCTGCCGAAGAGTGGACTTGCCGACGTATGCCTTCCAGCGCCACCTCGGCGCGGGGGGGTTCGCCAAA
GAGCAAGCACATAGACGACCAGACTCACATGGAGTTTGAGCTGGCCTGGCAGACAGCCGCCCCGGCCAAGTGGGC
GCGGTGCGCGCTGGCGGCACCTGGGGCTTGCTATGTCCAGCGGGACAGGTGCCTGGGGCCGGAGAGCTGGCTGAC
GCTCTGTCGCGGTCTGGGGTCCGCCTGGAGCAGGTCGGGCAGCTGGGCGAGGCAGAAGGGTTCGACGGGCTACTA
GGTCTGTGGAGCTCAAGCTCCAACGTGATAGACCAGACGCGGCATTTGCGCCCAAAGGTCGACGGCGCATGGCAC
CTCCATCAGCTCACGCGCTCCATAGACGCAGGCATGTTCGTCATGTTGTTCTCCATCTCTGGCGTCTTAGGCATG
CCAGGTCTTGCCATCTACGCCGCCGCAAACACCTTCCTCGACTCTCTCGCCCACCTACGTCGATCTCAGGGCCTA
CCGGCTACCTCACTGGCGTATGGCACCTGGCAGGATGATGGCATGGCGGCCGGCTCAACGCGGTCGACTTGGGCT
CACCTCACCCAATTCGGCCTTAACGATCTTACACCAAGCGACGGCCTACGCCTTCTTGAGCGGGCAGTACGCAGT
AAGCGTGCCCTCACCGTCGGCGCCTCGCTCGATTCTCGTCGACTTCGGGCCTATCTCGAGGACCGAGGCGGCATT
CCCCCTCTCTTCTATTCTCTCTTGGGTCACGGCGGTCCGCCTGCCAGCCGAAGCTGCCACCTTCGCGAGGCGCTA
GCTGTGGCACGCCGCGAGCAGCGCGCTGACCTTGTCATTGGCATGGTCCGGGTCTTGGTGGCCAAGGCATTGGGC
TTTGCCACTGCCGACGAGATCAGTATCGACCAACCCCTGTCGGAAATAGGTATCGACTCTTTGACGGCTGTCCTG
GTTCGCAACCATTTAGCGGCTCTCACCGGGCTCAAGCTCTCTGCGAACCTTGCCTTTCTTTATCCAAATATTCTC
AAGGCTCTGGCTGGCTTCTTCCTGTCCGAAATGCAGGACAGCCTTCTGGACGATACCTCGTCGACTCCACGTACG
CCAGTGTCCACGGTCTCGGGCGCGAATAACCACAGTATGACCGAGGGAAGCGCCCATTTAGATCTTGGAGCCATC
CGCAAGGGCTGCCTCGACTCCAGCTTCACATTTGAAAACCCTTCTCACCACACCGCCGCCCGCCTCGAGTCCGTT
TTCGTCACGGGCGCCACGGGCTTTATCGGTGCCTTCATCGTCGGAGAGCTGCTCCAGAGGCATATTCATGTCCAC
TGCCTCGTGCGTGCCGACAGCCTCGACCACGGGCGACGGCGCATCGTGGACACGCTTCGCGCTTATGGCCTCTGG
GCCGCTCACTACGACTCGCTGCTCCGCCCCTTGGTTCGTGATATGGCGCAGCCCTTCCTCGGCCTGCTAGACGAC
GACTTTGATCATCTGGCCCTACGCTTAGCTTCACGTGGACGAGGGAAGGCTGTCCATCTGATTTCCACAGTTGGT
ACAGTGCCCAGGCATGTCGGCTTCGACGTATCCGAGGAAGACTATGAGTATAACTACGCCACCTCCAAGTTTCTG
GCGGAACGTATGCCGGCCGCTGCTCGTTGGCGCGGCGCAAGGGCTTCTGCGTACCGTATCCCCTTTGTCACAGCC
TCCTCCTCGACCGGCCACTTTCGACTTGACCGCGGCGACTTTCTGCATAACTTGATCGTTGAAAGTATCGACATG
TGTGTGTCATCCCGTCCTTGGCTGGCGACCTATCCATCGTACTACCGGTTGACTACCTATGTCGGGCTATAGTTG
GCATAATAGTCATCCAAGACCCAGCTAAGATCGGCAAAGACTTTGACTTTACCAACACACGACCTCTGAGCTTCG
ACGATTTCTTTAAGCTGATGATCAAAGCCGGTGCTGGGCGGATGATTGTGCCGTTCCCTGACTGGAGGGACCAGG
CCCTAGCCACGGCCGGTGCGAGTGAAAAGGGTCCGCTGGCCCGCATCGCCGTCGTCCTCGACAACTGTACCGACG
AAAATGCGGCGGCCATGTTTGGTGCTCCGCCCGTGGGGCAGCACGTACTGGGAGGCAATGATTTCCCCGTGCCGC
CTGTCGATGACGAGTCTGTCGGCAAGTATATAAATCGCATTTTCCTCGCTCAGCAAATCGGCACCTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail