Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|6295
Gene name
Locationscaffold_543:1974..3994
Strand+
Gene length (bp)2020
Transcript length (bp)1734
Coding sequence length (bp)1731
Protein length (aa) 577

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF14737 DUF4470 Domain of unknown function (DUF4470) 1.7E-24 95 198
PF01753 zf-MYND MYND finger 1.2E-09 20 54

Swissprot hits

(None)

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 22 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|6295
MAEIPLLPAACAHWTRQGFWCKNPGTKTCSNCKLVVYCGVSCQRAHWPEHRKQCKSAMAKQSWRPAWDCEFRRPA
WAGDAAADTRHNPLGGRKHLWGNTPAIDMLQLEKNEGLDYQKDLSLLLAGESSGDLRHVVKTLSDVPETIHQQLH
VVVNDGDFDVVARNVILLLLAFDGFRDEASSVASIIEAIIHVWYSAFIPQTVFSRLQQRVKPLIDDVCSRLASEN
PDLVIRKSWEASNGASLNLVLRQEDWFRLRQFVNLPDGLTKEEASRIRAAVTLAPERADYRDRWNYKEATPFMRI
AKQRFREDGLLLPFGHPRLGFDIPNPTLFQSKTWTLHDQADPTGGWTISAVGQRSWPAPGDWYGKLVAHLTMLLD
KFITKLGKNFVCFQLFHTDARMLPLFLGARKYCRIEVSDMFDGGGFVGIHQTLSTLSPYLQHPKVNPHATLITVF
INAVKEMSLLENPAGEVPNVNILSRLLPRPSMLSLAFNDSADLTRLWDARFLVTNVERLFQSYMAVCRFDTISAE
VRVEMKADNTIVEKWPTRFNFRPGQNGNVDEFRLRLGSIFTHLERYVEWKRR
Coding >Ophio5|6295
ATGGCTGAAATCCCTCTACTCCCGGCCGCATGTGCTCACTGGACAAGACAAGGATTCTGGTGCAAGAACCCAGGC
ACCAAGACCTGCAGCAATTGCAAACTCGTCGTCTACTGCGGAGTAAGCTGCCAAAGAGCCCACTGGCCCGAGCAC
CGGAAGCAATGCAAGTCGGCCATGGCAAAGCAGTCTTGGCGCCCGGCCTGGGACTGCGAGTTCCGCAGACCGGCT
TGGGCGGGTGATGCTGCTGCCGACACAAGGCACAACCCCCTTGGCGGCAGAAAGCATCTATGGGGCAATACTCCC
GCCATCGACATGCTGCAACTGGAGAAGAATGAGGGGCTTGATTACCAGAAAGACCTCTCTTTACTACTCGCTGGC
GAGTCGTCGGGAGATTTGCGTCACGTCGTCAAGACCCTCTCCGATGTGCCAGAAACGATCCATCAGCAACTTCAT
GTCGTCGTCAACGACGGAGACTTTGATGTGGTGGCCAGGAACGTCATCTTGCTACTCCTTGCTTTCGATGGCTTC
CGCGACGAAGCATCATCTGTTGCGAGCATCATAGAAGCCATCATTCACGTCTGGTACTCGGCCTTTATCCCTCAG
ACGGTCTTCTCTCGACTGCAGCAACGCGTCAAGCCGTTGATCGACGACGTATGCAGCAGACTTGCGAGCGAGAAT
CCAGACTTGGTCATAAGGAAATCCTGGGAGGCTTCCAACGGAGCAAGTCTGAACCTTGTGCTGAGGCAGGAAGAC
TGGTTCCGACTCCGACAGTTCGTAAACCTACCCGACGGCCTAACGAAGGAAGAGGCAAGTCGCATACGCGCTGCT
GTGACCCTGGCTCCGGAGAGGGCAGATTACCGCGATCGATGGAACTACAAGGAGGCAACCCCTTTTATGCGCATC
GCCAAACAGCGATTTCGAGAAGACGGTCTCCTGTTGCCGTTTGGCCACCCACGACTCGGATTCGATATACCAAAT
CCGACCCTCTTCCAGTCCAAGACCTGGACTCTCCACGACCAGGCCGATCCAACCGGCGGCTGGACGATTTCTGCC
GTGGGACAGCGTTCTTGGCCTGCTCCCGGAGATTGGTACGGCAAACTCGTCGCTCACTTGACCATGTTGTTGGAC
AAGTTCATCACCAAGCTGGGCAAGAACTTTGTCTGCTTTCAACTCTTCCACACGGACGCACGGATGCTACCGCTG
TTCCTCGGGGCAAGGAAATACTGTCGAATCGAGGTATCCGACATGTTCGACGGAGGAGGCTTCGTCGGCATCCAC
CAAACTCTGTCCACCTTGTCCCCTTATCTACAGCATCCAAAGGTGAATCCTCACGCAACCCTCATCACCGTCTTT
ATCAACGCCGTCAAGGAGATGTCGTTACTGGAGAATCCTGCAGGGGAGGTGCCCAACGTGAATATCTTGTCTCGC
TTGCTTCCCCGTCCCTCGATGCTTTCCTTGGCCTTTAATGATAGCGCCGATCTTACCAGGCTTTGGGATGCGCGA
TTTCTCGTCACCAATGTGGAGAGGCTGTTCCAAAGCTATATGGCAGTGTGTCGGTTTGATACCATCTCCGCCGAG
GTGAGAGTTGAGATGAAAGCGGACAACACTATTGTCGAGAAGTGGCCTACTCGCTTCAACTTCCGTCCCGGTCAG
AATGGAAATGTCGACGAGTTTCGATTGCGTCTCGGTTCCATATTCACCCATCTGGAGCGTTATGTGGAGTGGAAG
AGACGA
Transcript >Ophio5|6295
ATGGCTGAAATCCCTCTACTCCCGGCCGCATGTGCTCACTGGACAAGACAAGGATTCTGGTGCAAGAACCCAGGC
ACCAAGACCTGCAGCAATTGCAAACTCGTCGTCTACTGCGGAGTAAGCTGCCAAAGAGCCCACTGGCCCGAGCAC
CGGAAGCAATGCAAGTCGGCCATGGCAAAGCAGTCTTGGCGCCCGGCCTGGGACTGCGAGTTCCGCAGACCGGCT
TGGGCGGGTGATGCTGCTGCCGACACAAGGCACAACCCCCTTGGCGGCAGAAAGCATCTATGGGGCAATACTCCC
GCCATCGACATGCTGCAACTGGAGAAGAATGAGGGGCTTGATTACCAGAAAGACCTCTCTTTACTACTCGCTGGC
GAGTCGTCGGGAGATTTGCGTCACGTCGTCAAGACCCTCTCCGATGTGCCAGAAACGATCCATCAGCAACTTCAT
GTCGTCGTCAACGACGGAGACTTTGATGTGGTGGCCAGGAACGTCATCTTGCTACTCCTTGCTTTCGATGGCTTC
CGCGACGAAGCATCATCTGTTGCGAGCATCATAGAAGCCATCATTCACGTCTGGTACTCGGCCTTTATCCCTCAG
ACGGTCTTCTCTCGACTGCAGCAACGCGTCAAGCCGTTGATCGACGACGTATGCAGCAGACTTGCGAGCGAGAAT
CCAGACTTGGTCATAAGGAAATCCTGGGAGGCTTCCAACGGAGCAAGTCTGAACCTTGTGCTGAGGCAGGAAGAC
TGGTTCCGACTCCGACAGTTCGTAAACCTACCCGACGGCCTAACGAAGGAAGAGGCAAGTCGCATACGCGCTGCT
GTGACCCTGGCTCCGGAGAGGGCAGATTACCGCGATCGATGGAACTACAAGGAGGCAACCCCTTTTATGCGCATC
GCCAAACAGCGATTTCGAGAAGACGGTCTCCTGTTGCCGTTTGGCCACCCACGACTCGGATTCGATATACCAAAT
CCGACCCTCTTCCAGTCCAAGACCTGGACTCTCCACGACCAGGCCGATCCAACCGGCGGCTGGACGATTTCTGCC
GTGGGACAGCGTTCTTGGCCTGCTCCCGGAGATTGGTACGGCAAACTCGTCGCTCACTTGACCATGTTGTTGGAC
AAGTTCATCACCAAGCTGGGCAAGAACTTTGTCTGCTTTCAACTCTTCCACACGGACGCACGGATGCTACCGCTG
TTCCTCGGGGCAAGGAAATACTGTCGAATCGAGGTATCCGACATGTTCGACGGAGGAGGCTTCGTCGGCATCCAC
CAAACTCTGTCCACCTTGTCCCCTTATCTACAGCATCCAAAGGTGAATCCTCACGCAACCCTCATCACCGTCTTT
ATCAACGCCGTCAAGGAGATGTCGTTACTGGAGAATCCTGCAGGGGAGGTGCCCAACGTGAATATCTTGTCTCGC
TTGCTTCCCCGTCCCTCGATGCTTTCCTTGGCCTTTAATGATAGCGCCGATCTTACCAGGCTTTGGGATGCGCGA
TTTCTCGTCACCAATGTGGAGAGGCTGTTCCAAAGCTATATGGCAGTGTGTCGGTTTGATACCATCTCCGCCGAG
GTGAGAGTTGAGATGAAAGCGGACAACACTATTGTCGAGAAGTGGCCTACTCGCTTCAACTTCCGTCCCGGTCAG
AATGGAAATGTCGACGAGTTTCGATTGCGTCTCGGTTCCATATTCACCCATCTGGAGCGTTATGTGGAGTGGAAG
AGACGATGA
Gene >Ophio5|6295
ATGGCTGAAATCCCTCTACTCCCGGCCGCATGTGCTCACTGGACAAGACAAGGATTCTGGTGCAAGAACCCAGGC
ACCAAGACCTGCAGCAATTGCAAACTCGTCGTCGTGAGTGCACACCGGATGGTAAGGAGCAGCAGATACTCATCA
TCATAACTCTAGTACTGCGGAGTAAGCTGCCAAAGAGCCCACTGGCCCGAGCACCGGAAGCAATGCAAGTCGGCC
ATGGCAAAGCAGTCTTGGCGCCCGGCCTGGGACTGCGAGTTCCGCAGACCGGCTTGGGCGGGTGATGCTGCTGCC
GACACAAGGCACAACCCCCTTGGCGGCAGAAAGCATCTATGGGGCAATACTCCCGCCATCGACATGCTGCAACTG
GAGAAGAATGAGGGGCTTGATTACCAGAAAGACCTCTCTTTACTACTCGCTGGCGAGTGTTTGGTCCAGGGCCCC
CTTGGGGAAGCCGTGGCGATGCTGACTTGTACCAGCGTCGGGAGATTTGCGTCACGTCGTCAAGACCCTCTCCGA
TGTGCCAGAAACGATCCATCAGCAACTTCATGTCGTCGTCAACGACGGAGACTTTGATGTGGTGGCCAGGAACGT
CATCTTGCTACTCCTTGCTTTCGATGGCTTCCGCGACGAAGCATCATCTGTTGCGAGCATCATAGAAGCCATCAT
TCACGTCTGGTACTCGGCCTTTATCCCTCAGACGGTCTTCTCTCGACTGCAGCAACGCGTCAAGCCGTTGATCGA
CGACGTATGCAGCAGACTTGCGAGCGAGAATCCAGACTTGGTCATAAGGAAATCCTGGGAGGCTTCCAACGGAGC
AAGTCTGAACCTTGTGCTGAGGCAGGAAGACTGGTTCCGACTCCGACAGTTCGTAAACCTACCCGACGGCCTAAC
GAAGGAAGAGGCAAGTCGCATACGCGCTGCTGTGACCCTGGCTCCGGAGAGGGCAGATTACCGCGATCGATGGAA
CTACAAGGAGGCAACCCCTTTTATGCGCATCGCCAAACAGCGATTTCGAGAAGACGGTCTCCTGTTGCCGTTTGG
CCACCCACGACTCGGATTCGATATACCAAATCCGTGCGTGTTGGGAGGGGAAAAAAAAAGAGAAGCTTTTTTACC
AAGGCTGACACTGACTGGAATTCAGGACCCTCTTCCAGTCCAAGACCTGGACTCTCCACGACCAGGCCGATCCAA
CCGGCGGCTGGACGATTTCTGCCGTGGGACAGCGTTCTTGGCCTGCTCCCGGAGATTGGTACGGCAAACTCGTCG
CTCACTTGACCATGTTGTTGGACAAGTTCATCACCAAGCTGGGCAAGAACTTTGTCTGCTTTCAACTCTTCCACA
CGGACGCACGGATGCTACCGCTGTTCCTCGGGGCAAGGAAATACTGTCGAATCGAGGTAAGGCCAGTACACGTCC
TCTTTGCATTCTGCGGCTAAACCCGTGGTCAGGTATCCGACATGTTCGACGGAGGAGGCTTCGTCGGCATCCACC
AAACTCTGTCCACCTTGTCCCCTTATCTACAGCATCCAAAGGTGAATCCTCACGCAACCCTCATCACCGTCTTTA
TCAACGCCGTCAAGGAGATGTCGTTACTGGAGAATCCTGCAGGGGAGGTGCCCAACGTGAATATCTTGTCTCGCT
TGCTTCCCCGTCCCTCGATGCTTTCCTTGGCCTTTAATGATAGCGCCGATCTTACCAGGCTTTGGGATGCGCGAT
TTCTCGTCACCAATGTGGAGAGGCTGTTCCAAAGGTAGGGAGGCAGATGGCATGAAAATCTCCGTGTCAGGCCCA
AAGCTGACAGACAGCCTCAAGCTATATGGCAGTGTGTCGGTTTGATACCATCTCCGCCGAGGTGAGAGTTGAGAT
GAAAGCGGACAACACTATTGTCGAGAAGTGGCCTACTCGCTTCAACTTCCGTCCCGGTCAGAATGGAAATGTCGA
CGAGTTTCGATTGCGTCTCGGTTCCATATTCACCCATCTGGAGCGTTATGTGGAGTGGAAGAGACGATGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail