Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|6292
Gene name
Locationscaffold_542:9896..10909
Strand-
Gene length (bp)1013
Transcript length (bp)915
Coding sequence length (bp)912
Protein length (aa) 304

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01066 CDP-OH_P_transf CDP-alcohol phosphatidyltransferase 2.0E-15 48 155

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q10153|PIS_SCHPO CDP-diacylglycerol--inositol 3-phosphatidyltransferase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pis1 PE=3 SV=1 52 294 1.0E-63
sp|P70500|CDIPT_RAT CDP-diacylglycerol--inositol 3-phosphatidyltransferase OS=Rattus norvegicus GN=Cdipt PE=1 SV=1 40 295 9.0E-54
sp|Q8VDP6|CDIPT_MOUSE CDP-diacylglycerol--inositol 3-phosphatidyltransferase OS=Mus musculus GN=Cdipt PE=1 SV=1 40 295 2.0E-53
sp|P06197|PIS_YEAST CDP-diacylglycerol--inositol 3-phosphatidyltransferase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PIS1 PE=1 SV=1 31 295 5.0E-52
sp|O14735|CDIPT_HUMAN CDP-diacylglycerol--inositol 3-phosphatidyltransferase OS=Homo sapiens GN=CDIPT PE=1 SV=1 40 295 9.0E-52
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q10153|PIS_SCHPO CDP-diacylglycerol--inositol 3-phosphatidyltransferase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pis1 PE=3 SV=1 52 294 1.0E-63
sp|P70500|CDIPT_RAT CDP-diacylglycerol--inositol 3-phosphatidyltransferase OS=Rattus norvegicus GN=Cdipt PE=1 SV=1 40 295 9.0E-54
sp|Q8VDP6|CDIPT_MOUSE CDP-diacylglycerol--inositol 3-phosphatidyltransferase OS=Mus musculus GN=Cdipt PE=1 SV=1 40 295 2.0E-53
sp|P06197|PIS_YEAST CDP-diacylglycerol--inositol 3-phosphatidyltransferase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PIS1 PE=1 SV=1 31 295 5.0E-52
sp|O14735|CDIPT_HUMAN CDP-diacylglycerol--inositol 3-phosphatidyltransferase OS=Homo sapiens GN=CDIPT PE=1 SV=1 40 295 9.0E-52
sp|Q8LBA6|PIS1_ARATH CDP-diacylglycerol--inositol 3-phosphatidyltransferase 1 OS=Arabidopsis thaliana GN=PIS1 PE=1 SV=2 43 199 1.0E-31
sp|Q8GUK6|PIS2_ARATH Probable CDP-diacylglycerol--inositol 3-phosphatidyltransferase 2 OS=Arabidopsis thaliana GN=PIS2 PE=2 SV=2 43 199 9.0E-30
sp|Q7N5C8|PGSA_PHOLL CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase OS=Photorhabdus luminescens subsp. laumondii (strain TT01) GN=pgsA PE=3 SV=1 49 130 4.0E-09
sp|Q57N57|PGSA_SALCH CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase OS=Salmonella choleraesuis (strain SC-B67) GN=pgsA PE=3 SV=3 49 130 8.0E-09
sp|Q7CQB9|PGSA_SALTY CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=pgsA PE=3 SV=3 49 130 1.0E-08
sp|Q5PI18|PGSA_SALPA CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=pgsA PE=3 SV=3 49 130 1.0E-08
sp|Q8XFD0|PGSA_SALTI CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase OS=Salmonella typhi GN=pgsA PE=3 SV=3 49 130 1.0E-08
sp|Q322L9|PGSA_SHIBS CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase OS=Shigella boydii serotype 4 (strain Sb227) GN=pgsA PE=3 SV=3 49 130 2.0E-08
sp|Q0T3L5|PGSA_SHIF8 CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase OS=Shigella flexneri serotype 5b (strain 8401) GN=pgsA PE=3 SV=1 49 130 2.0E-08
sp|Q83R47|PGSA_SHIFL CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase OS=Shigella flexneri GN=pgsA PE=3 SV=3 49 130 2.0E-08
sp|P0ABG0|PGSA_ECO57 CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase OS=Escherichia coli O157:H7 GN=pgsA PE=3 SV=2 49 130 2.0E-08
sp|P0ABF9|PGSA_ECOL6 CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=pgsA PE=3 SV=2 49 130 2.0E-08
sp|A1AC64|PGSA_ECOK1 CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase OS=Escherichia coli O1:K1 / APEC GN=pgsA PE=3 SV=1 49 130 2.0E-08
sp|Q0TGS6|PGSA_ECOL5 CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=pgsA PE=3 SV=1 49 130 2.0E-08
sp|P0ABF8|PGSA_ECOLI CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase OS=Escherichia coli (strain K12) GN=pgsA PE=1 SV=2 49 130 2.0E-08
sp|Q1RAM8|PGSA_ECOUT CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase OS=Escherichia coli (strain UTI89 / UPEC) GN=pgsA PE=3 SV=1 49 130 2.0E-08
sp|Q32HD9|PGSA_SHIDS CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase OS=Shigella dysenteriae serotype 1 (strain Sd197) GN=pgsA PE=3 SV=3 49 130 2.0E-08
sp|Q3Z2T6|PGSA_SHISS CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase OS=Shigella sonnei (strain Ss046) GN=pgsA PE=3 SV=3 49 130 2.0E-08
sp|Q2NTS8|PGSA_SODGM CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase OS=Sodalis glossinidius (strain morsitans) GN=pgsA PE=3 SV=1 49 130 4.0E-08
sp|A1JLU9|PGSA_YERE8 CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase OS=Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081) GN=pgsA PE=3 SV=1 49 130 7.0E-08
sp|Q7VR12|PGSA_BLOFL CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase OS=Blochmannia floridanus GN=pgsA PE=3 SV=1 49 128 4.0E-07
sp|Q492P7|PGSA_BLOPB CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase OS=Blochmannia pennsylvanicus (strain BPEN) GN=pgsA PE=3 SV=1 49 130 7.0E-07
sp|Q66BN4|PGSA_YERPS CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase OS=Yersinia pseudotuberculosis serotype I (strain IP32953) GN=pgsA PE=3 SV=1 49 111 7.0E-06
sp|A4TK40|PGSA_YERPP CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase OS=Yersinia pestis (strain Pestoides F) GN=pgsA PE=3 SV=1 49 111 7.0E-06
sp|Q1CHE5|PGSA_YERPN CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase OS=Yersinia pestis bv. Antiqua (strain Nepal516) GN=pgsA PE=3 SV=1 49 111 7.0E-06
sp|Q8ZF51|PGSA_YERPE CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase OS=Yersinia pestis GN=pgsA PE=3 SV=1 49 111 7.0E-06
sp|Q1C8L0|PGSA_YERPA CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase OS=Yersinia pestis bv. Antiqua (strain Antiqua) GN=pgsA PE=3 SV=1 49 111 7.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0016780 phosphotransferase activity, for other substituted phosphate groups Yes
GO:0016020 membrane Yes
GO:0008654 phospholipid biosynthetic process Yes
GO:0006793 phosphorus metabolic process No
GO:0044255 cellular lipid metabolic process No
GO:0008150 biological_process No
GO:0006796 phosphate-containing compound metabolic process No
GO:0044238 primary metabolic process No
GO:0006644 phospholipid metabolic process No
GO:1901576 organic substance biosynthetic process No
GO:0008152 metabolic process No
GO:0044237 cellular metabolic process No
GO:0003674 molecular_function No
GO:0016740 transferase activity No
GO:0009058 biosynthetic process No
GO:0071704 organic substance metabolic process No
GO:0110165 cellular anatomical entity No
GO:0009987 cellular process No
GO:0005575 cellular_component No
GO:0006629 lipid metabolic process No
GO:0019637 organophosphate metabolic process No
GO:0008610 lipid biosynthetic process No
GO:0016772 transferase activity, transferring phosphorus-containing groups No
GO:0003824 catalytic activity No
GO:0090407 organophosphate biosynthetic process No
GO:0044249 cellular biosynthetic process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.5

Transmembrane Domains

Domain # Start End Length
1 44 66 22
2 179 201 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|6292
MSASQNPLNPAKRRHDALLVNGSGNGSAHLNTLPDSDAAPSENIFLFWPNVIGYFRIVLAIASLYYMPLHPRTCS
VLYSVSCLLDALDGYAARFFNQSTRFGAVLDMVTDRCTTSCLLVFLSSAFPRWAILFQCLIALDFSSHYMHMYAT
LVVGGADSSHKNIDKSQSRLLNLYYSNKIVLFVFCSLNELFFIALYLLSFSSPLLSPHLIRGDDDSTGGVGAQVN
ASLLKQMFADPFSAGALELARANKMDSNGPWILAGISFPVMAMKQFINIVQLVKASKSLAEVDVKARRAKGLPAK
VKTG
Coding >Ophio5|6292
ATGTCTGCCAGCCAGAATCCTCTCAACCCCGCCAAAAGGCGCCATGATGCCCTCCTCGTCAACGGTAGTGGCAAC
GGCTCGGCTCATCTGAACACTCTCCCTGACTCGGATGCGGCTCCAAGCGAAAACATCTTCCTCTTCTGGCCCAAT
GTCATCGGCTACTTCCGAATCGTTCTCGCCATCGCCTCCCTCTACTACATGCCGCTGCACCCTCGCACCTGTTCC
GTCCTCTACAGCGTCTCGTGTCTGCTCGACGCCCTCGATGGCTACGCCGCCCGCTTCTTCAATCAATCCACCCGT
TTCGGCGCCGTCCTCGACATGGTGACGGACCGCTGCACCACGTCGTGCCTGCTCGTCTTTTTGTCGTCTGCTTTT
CCGCGATGGGCCATACTCTTCCAGTGCCTCATCGCCCTCGACTTCTCCAGCCACTACATGCACATGTACGCCACT
CTCGTCGTCGGCGGCGCCGACTCGAGCCACAAAAACATCGACAAGAGCCAGAGCAGACTGCTGAACCTCTACTAC
TCCAACAAGATTGTCCTCTTCGTCTTCTGCTCGCTCAATGAACTCTTCTTCATCGCCCTCTACCTACTGTCCTTT
TCGTCGCCCCTTCTTTCGCCCCACCTGATCAGAGGTGACGACGACTCGACCGGCGGAGTCGGCGCCCAGGTCAAT
GCCTCGCTTCTGAAGCAGATGTTCGCCGATCCCTTTAGCGCCGGCGCCCTCGAGCTCGCTCGTGCCAACAAGATG
GATTCTAACGGACCATGGATACTGGCCGGCATCAGCTTTCCCGTCATGGCCATGAAGCAGTTTATCAACATCGTA
CAGCTCGTCAAGGCCAGCAAGTCGCTGGCCGAGGTCGACGTCAAGGCCCGCCGGGCCAAGGGCCTCCCCGCAAAG
GTTAAGACGGGC
Transcript >Ophio5|6292
ATGTCTGCCAGCCAGAATCCTCTCAACCCCGCCAAAAGGCGCCATGATGCCCTCCTCGTCAACGGTAGTGGCAAC
GGCTCGGCTCATCTGAACACTCTCCCTGACTCGGATGCGGCTCCAAGCGAAAACATCTTCCTCTTCTGGCCCAAT
GTCATCGGCTACTTCCGAATCGTTCTCGCCATCGCCTCCCTCTACTACATGCCGCTGCACCCTCGCACCTGTTCC
GTCCTCTACAGCGTCTCGTGTCTGCTCGACGCCCTCGATGGCTACGCCGCCCGCTTCTTCAATCAATCCACCCGT
TTCGGCGCCGTCCTCGACATGGTGACGGACCGCTGCACCACGTCGTGCCTGCTCGTCTTTTTGTCGTCTGCTTTT
CCGCGATGGGCCATACTCTTCCAGTGCCTCATCGCCCTCGACTTCTCCAGCCACTACATGCACATGTACGCCACT
CTCGTCGTCGGCGGCGCCGACTCGAGCCACAAAAACATCGACAAGAGCCAGAGCAGACTGCTGAACCTCTACTAC
TCCAACAAGATTGTCCTCTTCGTCTTCTGCTCGCTCAATGAACTCTTCTTCATCGCCCTCTACCTACTGTCCTTT
TCGTCGCCCCTTCTTTCGCCCCACCTGATCAGAGGTGACGACGACTCGACCGGCGGAGTCGGCGCCCAGGTCAAT
GCCTCGCTTCTGAAGCAGATGTTCGCCGATCCCTTTAGCGCCGGCGCCCTCGAGCTCGCTCGTGCCAACAAGATG
GATTCTAACGGACCATGGATACTGGCCGGCATCAGCTTTCCCGTCATGGCCATGAAGCAGTTTATCAACATCGTA
CAGCTCGTCAAGGCCAGCAAGTCGCTGGCCGAGGTCGACGTCAAGGCCCGCCGGGCCAAGGGCCTCCCCGCAAAG
GTTAAGACGGGCTGA
Gene >Ophio5|6292
ATGTCTGCCAGCCAGAATCCTCTCAACCCCGCCAAAAGGCGCCATGATGCCCTCCTCGTCAACGGTAGTGGCAAC
GGCTCGGCTCATCTGAACACTCTCCCTGACTCGGATGCGGCTCCAAGCGAAAACATCTTCCTCTTCTGGCCCAAT
GTCATCGGTACGCTCGTTCCCATCCGTCTTTTCCGCCTGCTGACCGCCGCCAGGCTACTTCCGAATCGTTCTCGC
CATCGCCTCCCTCTACTACATGCCGCTGCACCCTCGCACCTGTTCCGTCCTCTACAGCGTCTCGTGTCTGCTCGA
CGCCCTCGATGGCTACGCCGCCCGCTTCTTCAATCAATCCACCCGTTTCGGCGCCGTCCTCGACATGGTGACGGA
CCGCTGCACCACGTCGTGCCTGCTCGTCTTTTTGTCGTCTGCTTTTCCGCGATGGGCCATACTCTTCCAGTGCCT
CATCGCCCTCGACTTCTCCAGCCACTACATGCACATGTACGCCACTCTCGTCGTCGGCGGCGCCGACTCGAGCCA
CAAAAACATCGACAAGAGCCAGAGCAGACTGCTGAACCTCTACTACTCCAACAAGGTCCGTCGGTCGTCGCGTCC
TGGATGCGCCCACTGACTCGTCGTCGTCGCAGATTGTCCTCTTCGTCTTCTGCTCGCTCAATGAACTCTTCTTCA
TCGCCCTCTACCTACTGTCCTTTTCGTCGCCCCTTCTTTCGCCCCACCTGATCAGAGGTGACGACGACTCGACCG
GCGGAGTCGGCGCCCAGGTCAATGCCTCGCTTCTGAAGCAGATGTTCGCCGATCCCTTTAGCGCCGGCGCCCTCG
AGCTCGCTCGTGCCAACAAGATGGATTCTAACGGACCATGGATACTGGCCGGCATCAGCTTTCCCGTCATGGCCA
TGAAGCAGTTTATCAACATCGTACAGCTCGTCAAGGCCAGCAAGTCGCTGGCCGAGGTCGACGTCAAGGCCCGCC
GGGCCAAGGGCCTCCCCGCAAAGGTTAAGACGGGCTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail