Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|6289
Gene name
Locationscaffold_542:409..2721
Strand+
Gene length (bp)2312
Transcript length (bp)2250
Coding sequence length (bp)2247
Protein length (aa) 749

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00505 HMG_box HMG (high mobility group) box 3.3E-22 109 177
PF09011 HMG_box_2 HMG-box domain 1.7E-06 110 176

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q5A220|RFG1_CANAL Repressor of filamentous growth 1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=RFG1 PE=2 SV=2 101 211 4.0E-17
sp|P0CY16|MTMC3_SCHPO Silenced mating-type M-specific polypeptide Mc OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mat3-Mc PE=3 SV=1 104 187 2.0E-15
sp|P0CY17|MATMC_SCHPO Mating-type M-specific polypeptide Mc OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mat1-Mc PE=2 SV=1 104 187 2.0E-15
sp|C7U331|MATMC_SCHPM Mating-type M-specific polypeptide Mc OS=Schizosaccharomyces pombe GN=mat3-Mc PE=2 SV=1 104 187 2.0E-15
sp|Q6WRX6|MATMC_SCHKA Mating-type M-specific polypeptide Mc OS=Schizosaccharomyces kambucha GN=matMc PE=3 SV=1 108 183 4.0E-15
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q5A220|RFG1_CANAL Repressor of filamentous growth 1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=RFG1 PE=2 SV=2 101 211 4.0E-17
sp|P0CY16|MTMC3_SCHPO Silenced mating-type M-specific polypeptide Mc OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mat3-Mc PE=3 SV=1 104 187 2.0E-15
sp|P0CY17|MATMC_SCHPO Mating-type M-specific polypeptide Mc OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mat1-Mc PE=2 SV=1 104 187 2.0E-15
sp|C7U331|MATMC_SCHPM Mating-type M-specific polypeptide Mc OS=Schizosaccharomyces pombe GN=mat3-Mc PE=2 SV=1 104 187 2.0E-15
sp|Q6WRX6|MATMC_SCHKA Mating-type M-specific polypeptide Mc OS=Schizosaccharomyces kambucha GN=matMc PE=3 SV=1 108 183 4.0E-15
sp|Q08143|SMR2_PODAS Sporulation minus regulator 2 OS=Podospora anserina GN=SMR2 PE=3 SV=1 103 182 3.0E-14
sp|P35693|FPR1_PODAS MAT+ sexual cell fertilization-promoting factor OS=Podospora anserina GN=FPR1 PE=3 SV=2 103 185 5.0E-14
sp|P25042|ROX1_YEAST Repressor ROX1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ROX1 PE=1 SV=1 107 182 7.0E-14
sp|P36981|MATB_NEUCS Mating-type protein a-1 OS=Neurospora crassa GN=mta-1 PE=1 SV=2 108 182 1.0E-12
sp|Q864Q4|SRY_MESST Sex-determining region Y protein OS=Mesoplodon stejnegeri GN=SRY PE=3 SV=1 108 216 4.0E-12
sp|Q864Q7|SRY_EUBAS Sex-determining region Y protein OS=Eubalaena australis GN=SRY PE=3 SV=1 108 216 1.0E-11
sp|P36389|SRY_HORSE Sex-determining region Y protein OS=Equus caballus GN=SRY PE=2 SV=2 108 185 3.0E-11
sp|Q864R1|SRY_BALBN Sex-determining region Y protein OS=Balaenoptera bonaerensis GN=SRY PE=3 SV=1 108 216 4.0E-11
sp|Q864R2|SRY_BALAC Sex-determining region Y protein OS=Balaenoptera acutorostrata GN=SRY PE=3 SV=1 108 216 4.0E-11
sp|Q864R0|SRY_BALMU Sex-determining region Y protein OS=Balaenoptera musculus GN=SRY PE=3 SV=1 108 216 5.0E-11
sp|Q864Q6|SRY_PHYCD Sex-determining region Y protein OS=Physeter catodon GN=SRY PE=3 SV=1 108 216 5.0E-11
sp|Q864Q5|SRY_KOGSI Sex-determining region Y protein OS=Kogia sima GN=SRY PE=3 SV=1 108 216 6.0E-11
sp|O60248|SOX15_HUMAN Protein SOX-15 OS=Homo sapiens GN=SOX15 PE=1 SV=1 105 192 8.0E-11
sp|P36393|SRY_PIG Sex-determining region Y protein OS=Sus scrofa GN=SRY PE=2 SV=3 108 192 9.0E-11
sp|Q9BG90|SRY_MACMU Sex-determining region Y protein OS=Macaca mulatta GN=SRY PE=2 SV=1 108 185 1.0E-10
sp|Q864Q8|SRY_MEGNO Sex-determining region Y protein OS=Megaptera novaeangliae GN=SRY PE=3 SV=1 108 216 1.0E-10
sp|Q864Q9|SRY_BALPH Sex-determining region Y protein OS=Balaenoptera physalus GN=SRY PE=3 SV=1 108 216 1.0E-10
sp|Q28447|SRY_HYLLA Sex-determining region Y protein OS=Hylobates lar GN=SRY PE=3 SV=1 108 185 2.0E-10
sp|Q864P7|SRY_GRAGR Sex-determining region Y protein OS=Grampus griseus GN=SRY PE=3 SV=1 101 185 3.0E-10
sp|Q864Q0|SRY_TURTR Sex-determining region Y protein OS=Tursiops truncatus GN=SRY PE=3 SV=1 101 185 3.0E-10
sp|Q864P6|SRY_PENEL Sex-determining region Y protein OS=Peponocephala electra GN=SRY PE=3 SV=1 101 185 3.0E-10
sp|Q864P3|SRY_ORCBR Sex-determining region Y protein OS=Orcaella brevirostris GN=SRY PE=3 SV=1 101 185 3.0E-10
sp|Q864P8|SRY_LAGOL Sex-determining region Y protein OS=Lagenorhynchus obliquidens GN=SRY PE=3 SV=1 101 185 3.0E-10
sp|Q864P4|SRY_GLOMA Sex-determining region Y protein OS=Globicephala macrorhynchus GN=SRY PE=3 SV=2 101 185 3.0E-10
sp|Q864P9|SRY_DELDE Sex-determining region Y protein OS=Delphinus delphis GN=SRY PE=3 SV=1 101 185 3.0E-10
sp|Q67EX7|SRY_MOSBE Sex-determining region Y protein OS=Moschus berezovskii GN=SRY PE=3 SV=1 109 195 3.0E-10
sp|Q864Q2|SRY_PHOPH Sex-determining region Y protein OS=Phocoena phocoena GN=SRY PE=3 SV=1 101 185 3.0E-10
sp|Q864Q1|SRY_NEOPH Sex-determining region Y protein OS=Neophocaena phocaenoides GN=SRY PE=3 SV=1 101 185 3.0E-10
sp|Q864P5|SRY_ORCOR Sex-determining region Y protein OS=Orcinus orca GN=SRY PE=3 SV=1 101 185 3.0E-10
sp|Q864Q3|SRY_DELLE Sex-determining region Y protein OS=Delphinapterus leucas GN=SRY PE=3 SV=1 101 185 3.0E-10
sp|Q28783|SRY_PONPY Sex-determining region Y protein OS=Pongo pygmaeus GN=SRY PE=3 SV=1 108 185 4.0E-10
sp|Q8AXQ4|SOX12_XENLA Transcription factor Sox-12 OS=Xenopus laevis GN=sox12 PE=2 SV=1 109 187 5.0E-10
sp|Q32PP9|SOX14_DANRE Transcription factor Sox-14 OS=Danio rerio GN=sox14 PE=2 SV=1 102 185 5.0E-10
sp|P43267|SOX15_MOUSE Protein SOX-15 OS=Mus musculus GN=Sox15 PE=1 SV=3 105 185 5.0E-10
sp|Q863D9|SRY_ALCAC Sex-determining region Y protein OS=Alces alces cameloides GN=SRY PE=3 SV=1 109 187 6.0E-10
sp|Q04890|SOX12_MOUSE Transcription factor SOX-12 OS=Mus musculus GN=Sox12 PE=2 SV=2 94 186 6.0E-10
sp|Q03255|SRY_BOVIN Sex-determining region Y protein OS=Bos taurus GN=SRY PE=3 SV=2 109 195 6.0E-10
sp|Q7JGF7|SRY_BOSIN Sex-determining region Y protein OS=Bos indicus GN=SRY PE=3 SV=1 109 195 6.0E-10
sp|Q7JGF9|SRY_BOSGF Sex-determining region Y protein OS=Bos gaurus frontalis GN=SRY PE=3 SV=1 109 195 6.0E-10
sp|Q27949|SRY_BISBO Sex-determining region Y protein OS=Bison bonasus GN=SRY PE=3 SV=2 109 195 6.0E-10
sp|Q8SPQ2|SRY_BISBI Sex-determining region Y protein OS=Bison bison GN=SRY PE=3 SV=1 109 195 7.0E-10
sp|P48046|SRY_GORGO Sex-determining region Y protein OS=Gorilla gorilla gorilla GN=SRY PE=3 SV=1 108 185 7.0E-10
sp|Q05066|SRY_HUMAN Sex-determining region Y protein OS=Homo sapiens GN=SRY PE=1 SV=1 108 185 9.0E-10
sp|Q69FB1|SRY_BUBBU Sex-determining region Y protein OS=Bubalus bubalis GN=SRY PE=3 SV=1 109 195 9.0E-10
sp|Q863B7|SRY_ELADA Sex-determining region Y protein OS=Elaphurus davidianus GN=SRY PE=3 SV=1 109 187 9.0E-10
sp|P61259|SOX14_MACFA Transcription factor SOX-14 OS=Macaca fascicularis GN=SOX14 PE=2 SV=1 102 185 9.0E-10
sp|O95416|SOX14_HUMAN Transcription factor SOX-14 OS=Homo sapiens GN=SOX14 PE=1 SV=1 102 185 9.0E-10
sp|Q9W7R6|SOX14_CHICK Transcription factor SOX-14 OS=Gallus gallus GN=SOX14 PE=2 SV=1 102 185 1.0E-09
sp|Q04892|SOX14_MOUSE Transcription factor SOX-14 OS=Mus musculus GN=Sox14 PE=2 SV=2 102 185 1.0E-09
sp|Q863C2|SRY_AXIPR Sex-determining region Y protein OS=Axis porcinus GN=SRY PE=3 SV=1 109 187 1.0E-09
sp|Q9BT81|SOX7_HUMAN Transcription factor SOX-7 OS=Homo sapiens GN=SOX7 PE=1 SV=1 108 187 1.0E-09
sp|Q6TC38|SRY_MIRLE Sex-determining region Y protein OS=Mirounga leonina GN=SRY PE=3 SV=1 108 182 1.0E-09
sp|A4QNG3|SOX14_XENTR Transcription factor Sox-14 OS=Xenopus tropicalis GN=sox14 PE=2 SV=1 102 185 1.0E-09
sp|Q6TC39|SRY_MIRAN Sex-determining region Y protein OS=Mirounga angustirostris GN=SRY PE=3 SV=1 108 182 1.0E-09
sp|O15370|SOX12_HUMAN Transcription factor SOX-12 OS=Homo sapiens GN=SOX12 PE=2 SV=2 104 186 1.0E-09
sp|B0ZTE2|SOX14_XENLA Transcription factor Sox-14 OS=Xenopus laevis GN=sox14 PE=2 SV=1 102 185 1.0E-09
sp|P57073|SOX8_HUMAN Transcription factor SOX-8 OS=Homo sapiens GN=SOX8 PE=2 SV=1 107 198 2.0E-09
sp|Q03256|SRY_CAPHI Sex-determining region Y protein OS=Capra hircus GN=SRY PE=3 SV=2 109 185 2.0E-09
sp|Q03257|SRY_SHEEP Sex-determining region Y protein OS=Ovis aries GN=SRY PE=3 SV=2 109 185 2.0E-09
sp|Q9DDD7|SX19B_DANRE Transcription factor Sox-19b OS=Danio rerio GN=sox19b PE=1 SV=1 103 186 2.0E-09
sp|P40646|SOX7_MOUSE Transcription factor SOX-7 OS=Mus musculus GN=Sox7 PE=1 SV=2 108 187 2.0E-09
sp|P51501|SRY_CALJA Sex-determining region Y protein OS=Callithrix jacchus GN=SRY PE=3 SV=1 108 182 2.0E-09
sp|Q06831|SOX4_MOUSE Transcription factor SOX-4 OS=Mus musculus GN=Sox4 PE=1 SV=2 104 198 2.0E-09
sp|Q9BH08|SRY_CERNI Sex-determining region Y protein OS=Cervus nippon GN=SRY PE=3 SV=1 109 207 3.0E-09
sp|O42342|SOX7_XENLA Transcription factor Sox-7 OS=Xenopus laevis GN=sox7 PE=2 SV=1 108 187 3.0E-09
sp|B3DLD3|SOX18_XENTR Transcription factor Sox-18 OS=Xenopus tropicalis GN=sox18 PE=2 SV=1 107 187 3.0E-09
sp|P47792|SX19A_DANRE Transcription factor Sox-19a OS=Danio rerio GN=sox19a PE=1 SV=2 105 185 3.0E-09
sp|Q28GD5|SOX7_XENTR Transcription factor Sox-7 OS=Xenopus tropicalis GN=sox7 PE=2 SV=1 108 187 4.0E-09
sp|Q8SPQ1|SRY_BOSJA Sex-determining region Y protein OS=Bos javanicus GN=SRY PE=3 SV=1 109 195 4.0E-09
sp|P36631|STE11_SCHPO Transcription factor ste11 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ste11 PE=1 SV=2 109 182 4.0E-09
sp|Q7SZS1|SX21A_DANRE Transcription factor Sox-21-A OS=Danio rerio GN=sox21a PE=2 SV=1 102 185 4.0E-09
sp|P40656|SOX14_DROME Putative transcription factor SOX-14 OS=Drosophila melanogaster GN=Sox14 PE=2 SV=3 109 203 4.0E-09
sp|Q67EX6|SRY_MOSCH Sex-determining region Y protein OS=Moschus chrysogaster GN=SRY PE=3 SV=1 109 195 5.0E-09
sp|B0ZTE1|SOX21_XENLA Transcription factor Sox-21 OS=Xenopus laevis GN=sox21 PE=2 SV=1 102 200 5.0E-09
sp|Q870J1|STE11_PNECA HMG-box protein STE11 OS=Pneumocystis carinii PE=1 SV=1 112 182 6.0E-09
sp|Q24533|DICH_DROME SOX domain-containing protein dichaete OS=Drosophila melanogaster GN=D PE=2 SV=1 109 182 6.0E-09
sp|Q04886|SOX8_MOUSE Transcription factor SOX-8 OS=Mus musculus GN=Sox8 PE=2 SV=2 107 198 6.0E-09
sp|Q9XS37|SRY_BOSMU Sex-determining region Y protein OS=Bos mutus grunniens GN=SRY PE=3 SV=1 109 195 6.0E-09
sp|Q28798|SRY_PANTR Sex-determining region Y protein OS=Pan troglodytes GN=SRY PE=2 SV=1 108 182 6.0E-09
sp|Q90ZH7|SX18B_XENLA Transcription factor Sox-18B OS=Xenopus laevis GN=sox18-b PE=1 SV=1 107 187 6.0E-09
sp|Q6TC28|SRY_LUTLU Sex-determining region Y protein OS=Lutra lutra GN=SRY PE=3 SV=1 109 182 7.0E-09
sp|Q9XT60|SRY_CANLF Sex-determining region Y protein OS=Canis lupus familiaris GN=SRY PE=3 SV=1 108 187 7.0E-09
sp|Q06945|SOX4_HUMAN Transcription factor SOX-4 OS=Homo sapiens GN=SOX4 PE=1 SV=1 104 186 8.0E-09
sp|Q6TC27|SRY_ENHLU Sex-determining region Y protein OS=Enhydra lutris GN=SRY PE=3 SV=1 109 182 8.0E-09
sp|P36395|SRY_SMIMA Sex-determining region Y protein OS=Sminthopsis macroura GN=SRY PE=2 SV=1 102 186 1.0E-08
sp|P43680|SOX18_MOUSE Transcription factor SOX-18 OS=Mus musculus GN=Sox18 PE=1 SV=3 108 187 1.0E-08
sp|Q90ZH8|SX18A_XENLA Transcription factor Sox-18A OS=Xenopus laevis GN=sox18-a PE=1 SV=1 107 187 1.0E-08
sp|P57074|SOX8_CHICK Transcription factor SOX-8 OS=Gallus gallus GN=SOX8 PE=2 SV=1 107 198 1.0E-08
sp|Q6NVN0|SOX2_XENTR Transcription factor Sox-2 OS=Xenopus tropicalis GN=sox2 PE=2 SV=1 108 185 1.0E-08
sp|P48433|SOX3_CHICK Transcription factor SOX-3 OS=Gallus gallus GN=SOX3 PE=2 SV=1 108 182 1.0E-08
sp|O42569|SOX2_XENLA Transcription factor Sox-2 OS=Xenopus laevis GN=sox2 PE=2 SV=1 108 185 1.0E-08
sp|Q2PG84|SOX1_XENLA Transcription factor Sox-1 OS=Xenopus laevis GN=sox1 PE=2 SV=1 108 182 1.0E-08
sp|Q6TC40|SRY_HYDLE Sex-determining region Y protein OS=Hydrurga leptonyx GN=SRY PE=3 SV=1 108 182 1.0E-08
sp|P35713|SOX18_HUMAN Transcription factor SOX-18 OS=Homo sapiens GN=SOX18 PE=1 SV=2 108 187 1.0E-08
sp|Q6TC43|SRY_CALUR Sex-determining region Y protein OS=Callorhinus ursinus GN=SRY PE=3 SV=1 108 182 2.0E-08
sp|P48430|SOX2_CHICK Transcription factor SOX-2 OS=Gallus gallus GN=SOX2 PE=1 SV=1 108 185 2.0E-08
sp|B1H349|SOX6_XENTR Transcription factor Sox-6 OS=Xenopus tropicalis GN=sox6 PE=2 SV=1 107 263 2.0E-08
sp|Q2Z1R2|SOX1B_DANRE Transcription factor Sox-1b OS=Danio rerio GN=sox1b PE=2 SV=1 108 182 2.0E-08
sp|Q6VVD7|SOX8_XENLA Transcription factor Sox-8 OS=Xenopus laevis GN=sox8 PE=2 SV=1 107 198 2.0E-08
sp|P36396|SRY_URSAR Sex-determining region Y protein OS=Ursus arctos GN=SRY PE=3 SV=2 108 182 2.0E-08
sp|P36390|SRY_HALGR Sex-determining region Y protein OS=Halichoerus grypus GN=SRY PE=3 SV=2 108 182 2.0E-08
sp|Q61473|SOX17_MOUSE Transcription factor SOX-17 OS=Mus musculus GN=Sox17 PE=1 SV=1 108 182 2.0E-08
sp|Q6DGL6|SOX1A_DANRE Transcription factor Sox-1a OS=Danio rerio GN=sox1a PE=2 SV=2 108 182 2.0E-08
sp|Q6RVD7|SX21B_DANRE Transcription factor Sox-21-B OS=Danio rerio GN=sox21b PE=2 SV=1 102 185 2.0E-08
sp|Q6TC46|SRY_EUMJU Sex-determining region Y protein OS=Eumetopias jubatus GN=SRY PE=3 SV=1 108 182 2.0E-08
sp|Q6TC33|SRY_PHOVI Sex-determining region Y protein OS=Phoca vitulina GN=SRY PE=3 SV=1 108 182 2.0E-08
sp|Q6TC31|SRY_PHOLR Sex-determining region Y protein OS=Phoca largha GN=SRY PE=3 SV=1 108 182 2.0E-08
sp|Q6TC30|SRY_ERIBA Sex-determining region Y protein OS=Erignathus barbatus GN=SRY PE=3 SV=1 108 182 2.0E-08
sp|Q6TC37|SRY_CYSCR Sex-determining region Y protein OS=Cystophora cristata GN=SRY PE=3 SV=1 108 182 2.0E-08
sp|Q6TC32|SRY_PUSHI Sex-determining region Y protein OS=Pusa hispida GN=SRY PE=3 SV=1 108 182 2.0E-08
sp|Q6TC36|SRY_PAGGO Sex-determining region Y protein OS=Pagophilus groenlandicus GN=SRY PE=3 SV=1 108 182 2.0E-08
sp|Q6TC45|SRY_ZALCA Sex-determining region Y protein OS=Zalophus californianus GN=SRY PE=3 SV=1 108 182 2.0E-08
sp|Q68FA4|SOX3_XENTR Transcription factor Sox-3 OS=Xenopus tropicalis GN=sox3 PE=2 SV=1 108 182 2.0E-08
sp|Q6T724|SRY_ARCFO Sex-determining region Y protein OS=Arctocephalus forsteri GN=SRY PE=3 SV=1 108 182 2.0E-08
sp|Q6T723|SRY_ARCAU Sex-determining region Y protein OS=Arctocephalus australis GN=SRY PE=3 SV=1 108 182 2.0E-08
sp|Q6TC44|SRY_ARCGZ Sex-determining region Y protein OS=Arctocephalus gazella GN=SRY PE=3 SV=1 108 182 2.0E-08
sp|A2TED3|SOX1_XENTR Transcription factor Sox-1 OS=Xenopus tropicalis GN=sox1 PE=2 SV=1 108 182 2.0E-08
sp|P53784|SOX3_MOUSE Transcription factor SOX-3 OS=Mus musculus GN=Sox3 PE=1 SV=2 108 182 2.0E-08
sp|Q5RCU4|SOX6_PONAB Transcription factor SOX-6 OS=Pongo abelii GN=SOX6 PE=2 SV=1 107 269 2.0E-08
sp|P35712|SOX6_HUMAN Transcription factor SOX-6 OS=Homo sapiens GN=SOX6 PE=1 SV=3 107 269 2.0E-08
sp|P41225|SOX3_HUMAN Transcription factor SOX-3 OS=Homo sapiens GN=SOX3 PE=1 SV=2 108 182 2.0E-08
sp|Q9W7R5|SOX21_CHICK Transcription factor SOX-21 OS=Gallus gallus GN=SOX21 PE=2 SV=1 102 185 2.0E-08
sp|Q9H6I2|SOX17_HUMAN Transcription factor SOX-17 OS=Homo sapiens GN=SOX17 PE=1 SV=1 108 182 3.0E-08
sp|Q90ZH9|S17AB_XENLA Transcription factor Sox-17-alpha-B OS=Xenopus laevis GN=sox17a-b PE=1 SV=1 108 182 3.0E-08
sp|Q9Y651|SOX21_HUMAN Transcription factor SOX-21 OS=Homo sapiens GN=SOX21 PE=2 SV=1 102 185 3.0E-08
sp|Q28778|SRY_PANPA Sex-determining region Y protein OS=Pan paniscus GN=SRY PE=3 SV=1 108 182 3.0E-08
sp|Q6TC50|SRY_FELCA Sex-determining region Y protein OS=Felis catus GN=SRY PE=3 SV=1 108 182 3.0E-08
sp|Q811W0|SOX21_MOUSE Transcription factor SOX-21 OS=Mus musculus GN=Sox21 PE=2 SV=1 102 185 3.0E-08
sp|Q6P0E1|SOX2_DANRE Transcription factor Sox-2 OS=Danio rerio GN=sox2 PE=2 SV=1 108 185 3.0E-08
sp|P40645|SOX6_MOUSE Transcription factor SOX-6 OS=Mus musculus GN=Sox6 PE=1 SV=2 107 269 3.0E-08
sp|P48432|SOX2_MOUSE Transcription factor SOX-2 OS=Mus musculus GN=Sox2 PE=1 SV=2 108 185 3.0E-08
sp|P55863|SOX3A_XENLA Transcription factor Sox-3-A OS=Xenopus laevis GN=sox3-a PE=1 SV=1 108 182 3.0E-08
sp|Q6TC34|SRY_PUSCA Sex-determining region Y protein OS=Pusa caspica GN=SRY PE=3 SV=1 108 182 4.0E-08
sp|B7ZR65|SOX9A_XENLA Transcription factor Sox-9-A OS=Xenopus laevis GN=sox9-a PE=1 SV=1 107 189 4.0E-08
sp|Q6DFF5|SOX9B_XENLA Transcription factor Sox-9-B OS=Xenopus laevis GN=sox9-b PE=2 SV=1 107 189 4.0E-08
sp|P48431|SOX2_HUMAN Transcription factor SOX-2 OS=Homo sapiens GN=SOX2 PE=1 SV=1 108 185 4.0E-08
sp|Q6IZ48|SOX8_TETNG Transcription factor Sox-8 OS=Tetraodon nigroviridis GN=sox8 PE=2 SV=2 107 198 4.0E-08
sp|P54231|SOX2_SHEEP Transcription factor SOX-2 OS=Ovis aries GN=SOX2 PE=3 SV=1 108 185 4.0E-08
sp|O57401|SOX1_CHICK Transcription factor SOX-1 OS=Gallus gallus GN=SOX1 PE=2 SV=1 108 182 4.0E-08
sp|P36394|SRY_RAT Sex-determining region Y protein (Fragment) OS=Rattus norvegicus GN=Sry PE=1 SV=2 108 186 4.0E-08
sp|P40657|SOX15_DROME Putative transcription factor SOX-15 OS=Drosophila melanogaster GN=Sox15 PE=2 SV=2 108 182 4.0E-08
sp|Q6F2E7|SOX9_XENTR Transcription factor Sox-9 OS=Xenopus tropicalis GN=sox9 PE=1 SV=1 107 189 5.0E-08
sp|O00570|SOX1_HUMAN Transcription factor SOX-1 OS=Homo sapiens GN=SOX1 PE=1 SV=2 108 182 5.0E-08
sp|Q5FWM3|SOX3B_XENLA Transcription factor Sox-3-B OS=Xenopus laevis GN=sox3-b PE=2 SV=1 108 182 5.0E-08
sp|Q8AWH3|SX17A_XENTR Transcription factor Sox-17-alpha OS=Xenopus tropicalis GN=sox17a PE=2 SV=1 108 182 5.0E-08
sp|P53783|SOX1_MOUSE Transcription factor SOX-1 OS=Mus musculus GN=Sox1 PE=2 SV=2 108 182 5.0E-08
sp|Q3KQ35|S17AA_XENLA Transcription factor Sox-17-alpha-A OS=Xenopus laevis GN=sox17a-a PE=1 SV=1 108 182 5.0E-08
sp|Q62563|SRY_MUSSP Sex-determining region Y protein OS=Mus spretus GN=Sry PE=3 SV=2 109 186 6.0E-08
sp|Q6TC41|SRY_MONSC Sex-determining region Y protein OS=Monachus schauinslandi GN=SRY PE=3 SV=1 108 181 6.0E-08
sp|Q66JF1|SOX11_XENTR Transcription factor Sox-11 OS=Xenopus tropicalis GN=sox11 PE=2 SV=1 109 196 6.0E-08
sp|O55170|SOX10_RAT Transcription factor SOX-10 OS=Rattus norvegicus GN=Sox10 PE=1 SV=1 107 188 7.0E-08
sp|P56693|SOX10_HUMAN Transcription factor SOX-10 OS=Homo sapiens GN=SOX10 PE=1 SV=1 107 188 7.0E-08
sp|A5A763|SOX10_PIG Transcription factor SOX-10 OS=Sus scrofa GN=SOX10 PE=2 SV=1 107 188 7.0E-08
sp|Q04888|SOX10_MOUSE Transcription factor SOX-10 OS=Mus musculus GN=Sox10 PE=2 SV=2 107 188 7.0E-08
sp|P40650|SX11B_XENLA Transcription factor Sox-11-B OS=Xenopus laevis GN=sox11-b PE=1 SV=2 109 186 8.0E-08
sp|Q91731|SX11A_XENLA Transcription factor Sox-11-A OS=Xenopus laevis GN=sox11-a PE=1 SV=2 109 186 8.0E-08
sp|Q7M6Y2|SOX11_MOUSE Transcription factor SOX-11 OS=Mus musculus GN=Sox11 PE=1 SV=1 104 182 9.0E-08
sp|P0C1G9|SOX11_RAT Transcription factor SOX-11 OS=Rattus norvegicus GN=Sox11 PE=2 SV=1 104 182 9.0E-08
sp|Q9W757|SOX10_CHICK Transcription factor SOX-10 OS=Gallus gallus GN=SOX10 PE=2 SV=2 107 188 1.0E-07
sp|Q05738|SRY_MOUSE Sex-determining region Y protein OS=Mus musculus GN=Sry PE=1 SV=2 109 186 1.0E-07
sp|Q62565|SRY_MUSSI Sex-determining region Y protein OS=Mus spicilegus GN=Sry PE=3 SV=2 109 186 1.0E-07
sp|P48435|SOX11_CHICK Transcription factor SOX-11 OS=Gallus gallus GN=SOX11 PE=2 SV=1 109 185 1.0E-07
sp|P35716|SOX11_HUMAN Transcription factor SOX-11 OS=Homo sapiens GN=SOX11 PE=1 SV=2 104 182 1.0E-07
sp|Q8AXX8|SOX10_XENLA Transcription factor Sox-10 OS=Xenopus laevis GN=sox10 PE=1 SV=1 107 182 1.0E-07
sp|P40649|SOX13_XENLA Transcription factor Sox-13 OS=Xenopus laevis GN=sox13 PE=2 SV=3 109 181 1.0E-07
sp|A4IIJ8|SOX10_XENTR Transcription factor Sox-10 OS=Xenopus tropicalis GN=sox10 PE=2 SV=1 107 182 2.0E-07
sp|Q04887|SOX9_MOUSE Transcription factor SOX-9 OS=Mus musculus GN=Sox9 PE=2 SV=2 107 198 2.0E-07
sp|Q6EJB7|SOX3_DANRE Transcription factor Sox-3 OS=Danio rerio GN=sox3 PE=1 SV=1 108 182 2.0E-07
sp|Q6GLH8|S17B2_XENTR Transcription factor Sox-17-beta.2 OS=Xenopus tropicalis GN=sox17b.2 PE=2 SV=2 108 182 2.0E-07
sp|P61754|SOX9_PONPY Transcription factor SOX-9 OS=Pongo pygmaeus GN=SOX9 PE=2 SV=1 107 198 2.0E-07
sp|P61753|SOX9_MACMU Transcription factor SOX-9 OS=Macaca mulatta GN=SOX9 PE=2 SV=1 107 198 2.0E-07
sp|P48436|SOX9_HUMAN Transcription factor SOX-9 OS=Homo sapiens GN=SOX9 PE=1 SV=1 107 198 2.0E-07
sp|Q9BG91|SOX9_CALJA Transcription factor SOX-9 OS=Callithrix jacchus GN=SOX9 PE=2 SV=1 107 198 2.0E-07
sp|O18896|SOX9_PIG Transcription factor SOX-9 OS=Sus scrofa GN=SOX9 PE=2 SV=1 107 198 2.0E-07
sp|A5D8R3|S17B3_XENLA Transcription factor Sox-17-beta.3 OS=Xenopus laevis GN=sox17b.3 PE=2 SV=1 108 187 2.0E-07
sp|Q7YRJ7|SOX9_CANLF Transcription factor SOX-9 OS=Canis lupus familiaris GN=SOX9 PE=2 SV=1 107 198 2.0E-07
sp|Q9BG89|SOX9_PANTR Transcription factor SOX-9 OS=Pan troglodytes GN=SOX9 PE=2 SV=1 107 198 3.0E-07
sp|O42601|S17B1_XENLA Transcription factor Sox-17-beta.1 OS=Xenopus laevis GN=sox17b.1 PE=1 SV=1 108 187 3.0E-07
sp|Q8AWH2|S17B1_XENTR Transcription factor Sox-17-beta.1 OS=Xenopus tropicalis GN=sox17b.1 PE=2 SV=1 108 182 3.0E-07
sp|P40639|AES4_ALLMI SRY-related protein AES4 (Fragment) OS=Alligator mississippiensis PE=3 SV=1 109 180 3.0E-07
sp|P40647|SOX5_XENLA Transcription factor Sox-5 OS=Xenopus laevis GN=sox5 PE=2 SV=2 107 181 3.0E-07
sp|P48434|SOX9_CHICK Transcription factor SOX-9 OS=Gallus gallus GN=SOX9 PE=1 SV=3 107 189 3.0E-07
sp|Q6F2F0|S17B3_XENTR Transcription factor Sox-17-beta.3 OS=Xenopus tropicalis GN=sox17b.3 PE=3 SV=2 108 182 3.0E-07
sp|B3DM43|SOX5_XENTR Transcription factor Sox-5 OS=Xenopus tropicalis GN=sox5 PE=2 SV=1 107 181 3.0E-07
sp|P35710|SOX5_MOUSE Transcription factor SOX-5 OS=Mus musculus GN=Sox5 PE=1 SV=2 107 181 3.0E-07
sp|P35711|SOX5_HUMAN Transcription factor SOX-5 OS=Homo sapiens GN=SOX5 PE=1 SV=3 107 181 3.0E-07
sp|Q23045|EGL13_CAEEL Transcription factor egl-13 OS=Caenorhabditis elegans GN=egl-13 PE=1 SV=2 109 181 4.0E-07
sp|Q02991|MAT2_COCHE Mating-type protein MAT-2 OS=Cochliobolus heterostrophus GN=MAT2 PE=3 SV=1 108 182 4.0E-07
sp|Q9P445|MAT2_COCSA Mating-type protein MAT-2 OS=Cochliobolus sativus GN=MAT2 PE=3 SV=1 93 182 6.0E-07
sp|Q28EW4|SOX13_XENTR Transcription factor Sox-13 OS=Xenopus tropicalis GN=sox13 PE=2 SV=1 109 181 8.0E-07
sp|P40637|AES1_ALLMI SRY-related protein AES1 (Fragment) OS=Alligator mississippiensis PE=3 SV=1 109 180 9.0E-07
sp|P40640|AES6_ALLMI SRY-related protein AES6 (Fragment) OS=Alligator mississippiensis PE=3 SV=1 109 180 1.0E-06
sp|Q9UN79|SOX13_HUMAN Transcription factor SOX-13 OS=Homo sapiens GN=SOX13 PE=1 SV=3 109 181 2.0E-06
sp|Q04891|SOX13_MOUSE Transcription factor SOX-13 OS=Mus musculus GN=Sox13 PE=2 SV=4 109 181 2.0E-06
sp|P40635|ADW4_ALLMI SRY-related protein ADW4 (Fragment) OS=Alligator mississippiensis PE=3 SV=1 109 180 2.0E-06
sp|Q10116|MATD_NEUCR Mating-type protein A-3 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=mtA-3 PE=2 SV=1 111 181 3.0E-06
sp|P40638|AES2_ALLMI SRY-related protein AES2 (Fragment) OS=Alligator mississippiensis PE=3 SV=1 109 180 5.0E-06
sp|P40634|ADW2_ALLMI SRY-related protein ADW2 (Fragment) OS=Alligator mississippiensis PE=3 SV=1 109 180 7.0E-06
sp|P40636|ADW5_ALLMI SRY-related protein ADW5 (Fragment) OS=Alligator mississippiensis PE=3 SV=2 109 180 9.0E-06
[Show less]

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Nucleus Nuclear localization signal 0.3356 0.8629 0.213 0.0463 0.0844 0.0007 0.0266 0.0465 0.0105 0.0067

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

Transcription Factor Class
(based on PFAM domains)
HMG

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup3079
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|638
Ophiocordyceps australis map64 (Brazil) OphauB2|5980
Ophiocordyceps camponoti-floridani Ophcf2|01853
Ophiocordyceps camponoti-rufipedis Ophun1|6706
Ophiocordyceps kimflemingae Ophio5|6289 (this protein)
Ophiocordyceps subramaniannii Hirsu2|5347

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|6289
MTQVLGLARQMEAALGGVQPRHHVGSGRLSPSPPGTGPFRRRATTLGAAVEAGRGVLEPLQRQQQGQQQQQQQQQ
QQQQQQQLQHQHQHQHQQDASRELICLCTPAPKIPRPRNAFILYRQHHQAQVTADNPKLSNPDISKIIGDKWKKE
SEGIKQNWKRLAEEEKQRHQNQYPNYRYQPRRGNKAQAGWPSTTSPTEDHGRCPRCHGRPMATPQTPSTPFSTSP
AGKLAAVTPQALQRLDTTPVSRRSSLDHSPTSLLPFPSKLPPVRDVEQAESVSPDSKRRRADGAGGYHSISGASR
YGPGSDLPLASADGLPPNPILSYARTPTTLPELGSLTRSQSGPMPPPPTSLRNQSASTPWLVDKDRRHSCFDESL
RLPPLQSPLSPSPVRSSQSIMDVRSVGLSSALTLSSPPPRRDQANARQSPQTLEDMVMAISFQRKVALMASICPP
APPLRKDGSRGQATRGAFIAVEGPNTTLRRGAGNAIQKGLMACGEVQLKVWHDHDRDEDVPDTISPTTTMTTTTT
ATTTATTTANTSPTTPTETADGDFDGGQQASRGGTPAVRFGDVFEPYFKTMASWQKRAKQIGRHITGTKAPDDYG
SGDEQRADGEHVTALTETAADEAAAPSTQAIPVALAKEGFSLTIADRYACAMPIPDSYGAAEHWQWMATLWRGTL
CPDLIVYVTSGSGDSNERRTVELSRRMGLIVVKVPAGKGLDEATERRLAFEVMEWMREGSFREPLPRDWRWHMP
Coding >Ophio5|6289
ATGACGCAGGTTCTTGGGCTGGCCCGACAGATGGAGGCTGCGCTAGGGGGCGTGCAGCCGCGCCATCACGTCGGT
AGTGGACGGCTTTCGCCTTCGCCGCCTGGCACGGGTCCGTTTAGGAGGCGGGCGACGACGCTGGGGGCTGCTGTC
GAAGCTGGTCGCGGCGTGTTGGAGCCGCTTCAGAGGCAGCAGCAGGGGCAGCAGCAGCAACAACAACAGCAACAG
CAACAGCAACAGCAGCAGCAGCTTCAGCACCAACACCAGCACCAACACCAGCAGGACGCCTCACGAGAGCTCATC
TGCCTCTGCACTCCGGCGCCCAAAATTCCCCGGCCGCGAAACGCTTTCATCCTTTATCGCCAGCACCACCAGGCC
CAGGTCACAGCCGATAATCCCAAGCTGTCCAACCCAGACATCTCCAAGATCATCGGCGACAAGTGGAAGAAGGAG
AGCGAAGGCATCAAGCAGAACTGGAAGCGCCTCGCCGAGGAGGAGAAGCAACGGCACCAGAACCAATATCCCAAC
TATCGCTACCAGCCGCGTCGCGGAAACAAAGCTCAGGCTGGCTGGCCATCTACCACGTCGCCTACCGAGGACCAT
GGCCGCTGCCCCAGATGCCATGGCCGGCCCATGGCTACGCCCCAGACGCCGTCGACGCCCTTCTCCACGTCGCCC
GCCGGCAAGCTGGCCGCCGTCACGCCTCAGGCCCTGCAGAGGCTGGACACGACGCCCGTGTCGCGCCGTTCGAGC
TTGGACCACTCCCCTACGAGCTTGCTACCGTTTCCCTCCAAGCTGCCGCCCGTCCGCGACGTCGAGCAGGCCGAG
TCCGTGTCGCCGGACTCCAAGAGGCGTCGCGCTGATGGAGCTGGTGGCTATCATAGCATCTCCGGCGCTTCTCGT
TACGGCCCCGGCTCCGACCTCCCCCTCGCCTCGGCCGACGGACTGCCGCCCAACCCGATCCTCTCCTACGCCCGT
ACGCCCACCACCTTGCCGGAGCTGGGCAGCCTGACCAGGTCCCAGAGCGGCCCCATGCCACCGCCACCGACGTCG
CTGCGGAACCAGTCGGCTTCTACGCCCTGGCTCGTCGACAAGGACCGCCGTCACAGCTGCTTCGACGAGTCGCTT
CGTCTCCCGCCACTTCAGTCGCCGCTATCGCCCTCTCCCGTGCGCTCCTCCCAGTCCATCATGGACGTCCGTTCC
GTCGGCCTTTCGTCGGCCCTGACGCTGTCGTCGCCTCCGCCACGTCGAGACCAGGCAAATGCCCGACAGAGCCCG
CAGACGCTCGAGGACATGGTCATGGCTATATCCTTCCAGCGCAAGGTGGCCTTGATGGCGAGCATCTGCCCGCCC
GCCCCGCCGCTACGCAAGGACGGCAGCAGAGGCCAGGCCACTCGCGGCGCCTTCATCGCCGTAGAGGGTCCCAAC
ACGACGCTGCGCAGGGGCGCCGGCAACGCCATCCAGAAGGGGCTCATGGCTTGCGGCGAGGTGCAGCTCAAGGTG
TGGCATGATCACGATCGGGACGAGGACGTGCCGGACACCATCAGCCCGACGACGACGATGACGACGACGACCACT
GCCACGACCACTGCCACGACGACGGCCAACACCTCGCCCACCACGCCGACAGAGACGGCAGACGGCGACTTTGAC
GGGGGGCAGCAGGCCAGCCGCGGAGGCACACCGGCGGTCCGGTTCGGCGACGTCTTCGAGCCCTACTTCAAGACC
ATGGCCTCGTGGCAGAAGCGGGCCAAGCAGATCGGCCGACACATCACCGGGACCAAGGCGCCCGACGACTACGGC
AGCGGCGATGAGCAGCGTGCGGACGGCGAGCACGTAACGGCCCTGACGGAGACGGCGGCGGACGAGGCGGCGGCG
CCGTCGACGCAGGCGATACCGGTAGCCCTGGCCAAGGAAGGCTTCAGCCTCACCATAGCGGACCGATACGCGTGC
GCGATGCCGATCCCGGACAGCTACGGCGCGGCCGAGCATTGGCAGTGGATGGCGACGCTGTGGCGCGGCACGCTG
TGTCCGGACCTCATCGTCTACGTCACCTCGGGCAGCGGCGACAGCAATGAGCGTAGGACGGTCGAGCTGTCTCGC
CGCATGGGGCTCATCGTCGTCAAGGTGCCGGCCGGAAAGGGCCTCGACGAGGCGACGGAGAGGAGGCTGGCCTTT
GAGGTCATGGAGTGGATGCGCGAGGGGTCGTTTCGCGAGCCGTTGCCGAGGGATTGGCGGTGGCATATGCCT
Transcript >Ophio5|6289
ATGACGCAGGTTCTTGGGCTGGCCCGACAGATGGAGGCTGCGCTAGGGGGCGTGCAGCCGCGCCATCACGTCGGT
AGTGGACGGCTTTCGCCTTCGCCGCCTGGCACGGGTCCGTTTAGGAGGCGGGCGACGACGCTGGGGGCTGCTGTC
GAAGCTGGTCGCGGCGTGTTGGAGCCGCTTCAGAGGCAGCAGCAGGGGCAGCAGCAGCAACAACAACAGCAACAG
CAACAGCAACAGCAGCAGCAGCTTCAGCACCAACACCAGCACCAACACCAGCAGGACGCCTCACGAGAGCTCATC
TGCCTCTGCACTCCGGCGCCCAAAATTCCCCGGCCGCGAAACGCTTTCATCCTTTATCGCCAGCACCACCAGGCC
CAGGTCACAGCCGATAATCCCAAGCTGTCCAACCCAGACATCTCCAAGATCATCGGCGACAAGTGGAAGAAGGAG
AGCGAAGGCATCAAGCAGAACTGGAAGCGCCTCGCCGAGGAGGAGAAGCAACGGCACCAGAACCAATATCCCAAC
TATCGCTACCAGCCGCGTCGCGGAAACAAAGCTCAGGCTGGCTGGCCATCTACCACGTCGCCTACCGAGGACCAT
GGCCGCTGCCCCAGATGCCATGGCCGGCCCATGGCTACGCCCCAGACGCCGTCGACGCCCTTCTCCACGTCGCCC
GCCGGCAAGCTGGCCGCCGTCACGCCTCAGGCCCTGCAGAGGCTGGACACGACGCCCGTGTCGCGCCGTTCGAGC
TTGGACCACTCCCCTACGAGCTTGCTACCGTTTCCCTCCAAGCTGCCGCCCGTCCGCGACGTCGAGCAGGCCGAG
TCCGTGTCGCCGGACTCCAAGAGGCGTCGCGCTGATGGAGCTGGTGGCTATCATAGCATCTCCGGCGCTTCTCGT
TACGGCCCCGGCTCCGACCTCCCCCTCGCCTCGGCCGACGGACTGCCGCCCAACCCGATCCTCTCCTACGCCCGT
ACGCCCACCACCTTGCCGGAGCTGGGCAGCCTGACCAGGTCCCAGAGCGGCCCCATGCCACCGCCACCGACGTCG
CTGCGGAACCAGTCGGCTTCTACGCCCTGGCTCGTCGACAAGGACCGCCGTCACAGCTGCTTCGACGAGTCGCTT
CGTCTCCCGCCACTTCAGTCGCCGCTATCGCCCTCTCCCGTGCGCTCCTCCCAGTCCATCATGGACGTCCGTTCC
GTCGGCCTTTCGTCGGCCCTGACGCTGTCGTCGCCTCCGCCACGTCGAGACCAGGCAAATGCCCGACAGAGCCCG
CAGACGCTCGAGGACATGGTCATGGCTATATCCTTCCAGCGCAAGGTGGCCTTGATGGCGAGCATCTGCCCGCCC
GCCCCGCCGCTACGCAAGGACGGCAGCAGAGGCCAGGCCACTCGCGGCGCCTTCATCGCCGTAGAGGGTCCCAAC
ACGACGCTGCGCAGGGGCGCCGGCAACGCCATCCAGAAGGGGCTCATGGCTTGCGGCGAGGTGCAGCTCAAGGTG
TGGCATGATCACGATCGGGACGAGGACGTGCCGGACACCATCAGCCCGACGACGACGATGACGACGACGACCACT
GCCACGACCACTGCCACGACGACGGCCAACACCTCGCCCACCACGCCGACAGAGACGGCAGACGGCGACTTTGAC
GGGGGGCAGCAGGCCAGCCGCGGAGGCACACCGGCGGTCCGGTTCGGCGACGTCTTCGAGCCCTACTTCAAGACC
ATGGCCTCGTGGCAGAAGCGGGCCAAGCAGATCGGCCGACACATCACCGGGACCAAGGCGCCCGACGACTACGGC
AGCGGCGATGAGCAGCGTGCGGACGGCGAGCACGTAACGGCCCTGACGGAGACGGCGGCGGACGAGGCGGCGGCG
CCGTCGACGCAGGCGATACCGGTAGCCCTGGCCAAGGAAGGCTTCAGCCTCACCATAGCGGACCGATACGCGTGC
GCGATGCCGATCCCGGACAGCTACGGCGCGGCCGAGCATTGGCAGTGGATGGCGACGCTGTGGCGCGGCACGCTG
TGTCCGGACCTCATCGTCTACGTCACCTCGGGCAGCGGCGACAGCAATGAGCGTAGGACGGTCGAGCTGTCTCGC
CGCATGGGGCTCATCGTCGTCAAGGTGCCGGCCGGAAAGGGCCTCGACGAGGCGACGGAGAGGAGGCTGGCCTTT
GAGGTCATGGAGTGGATGCGCGAGGGGTCGTTTCGCGAGCCGTTGCCGAGGGATTGGCGGTGGCATATGCCTTGA
Gene >Ophio5|6289
ATGACGCAGGTTCTTGGGCTGGCCCGACAGATGGAGGCTGCGCTAGGGGGCGTGCAGCCGCGCCATCACGTCGGT
AGTGGACGGCTTTCGCCTTCGCCGCCTGGCACGGGTCCGTTTAGGAGGCGGGCGACGACGCTGGGGGCTGCTGTC
GAAGCTGGTCGCGGCGTGTTGGAGCCGCTTCAGAGGCAGCAGCAGGGGCAGCAGCAGCAACAACAACAGCAACAG
CAACAGCAACAGCAGCAGCAGCTTCAGCACCAACACCAGCACCAACACCAGCAGGACGCCTCACGAGAGCTCATC
TGCCTCTGCACTCCGGCGCCCAAAATTCCCCGGCCGCGAAACGGTACGTCCTTTCGTCCGTCTGTTCTTCTTCAT
GTATTCTTCTGGCTGACGGCCTCGTCACAGCTTTCATCCTTTATCGCCAGCACCACCAGGCCCAGGTCACAGCCG
ATAATCCCAAGCTGTCCAACCCAGACATCTCCAAGATCATCGGCGACAAGTGGAAGAAGGAGAGCGAAGGCATCA
AGCAGAACTGGAAGCGCCTCGCCGAGGAGGAGAAGCAACGGCACCAGAACCAATATCCCAACTATCGCTACCAGC
CGCGTCGCGGAAACAAAGCTCAGGCTGGCTGGCCATCTACCACGTCGCCTACCGAGGACCATGGCCGCTGCCCCA
GATGCCATGGCCGGCCCATGGCTACGCCCCAGACGCCGTCGACGCCCTTCTCCACGTCGCCCGCCGGCAAGCTGG
CCGCCGTCACGCCTCAGGCCCTGCAGAGGCTGGACACGACGCCCGTGTCGCGCCGTTCGAGCTTGGACCACTCCC
CTACGAGCTTGCTACCGTTTCCCTCCAAGCTGCCGCCCGTCCGCGACGTCGAGCAGGCCGAGTCCGTGTCGCCGG
ACTCCAAGAGGCGTCGCGCTGATGGAGCTGGTGGCTATCATAGCATCTCCGGCGCTTCTCGTTACGGCCCCGGCT
CCGACCTCCCCCTCGCCTCGGCCGACGGACTGCCGCCCAACCCGATCCTCTCCTACGCCCGTACGCCCACCACCT
TGCCGGAGCTGGGCAGCCTGACCAGGTCCCAGAGCGGCCCCATGCCACCGCCACCGACGTCGCTGCGGAACCAGT
CGGCTTCTACGCCCTGGCTCGTCGACAAGGACCGCCGTCACAGCTGCTTCGACGAGTCGCTTCGTCTCCCGCCAC
TTCAGTCGCCGCTATCGCCCTCTCCCGTGCGCTCCTCCCAGTCCATCATGGACGTCCGTTCCGTCGGCCTTTCGT
CGGCCCTGACGCTGTCGTCGCCTCCGCCACGTCGAGACCAGGCAAATGCCCGACAGAGCCCGCAGACGCTCGAGG
ACATGGTCATGGCTATATCCTTCCAGCGCAAGGTGGCCTTGATGGCGAGCATCTGCCCGCCCGCCCCGCCGCTAC
GCAAGGACGGCAGCAGAGGCCAGGCCACTCGCGGCGCCTTCATCGCCGTAGAGGGTCCCAACACGACGCTGCGCA
GGGGCGCCGGCAACGCCATCCAGAAGGGGCTCATGGCTTGCGGCGAGGTGCAGCTCAAGGTGTGGCATGATCACG
ATCGGGACGAGGACGTGCCGGACACCATCAGCCCGACGACGACGATGACGACGACGACCACTGCCACGACCACTG
CCACGACGACGGCCAACACCTCGCCCACCACGCCGACAGAGACGGCAGACGGCGACTTTGACGGGGGGCAGCAGG
CCAGCCGCGGAGGCACACCGGCGGTCCGGTTCGGCGACGTCTTCGAGCCCTACTTCAAGACCATGGCCTCGTGGC
AGAAGCGGGCCAAGCAGATCGGCCGACACATCACCGGGACCAAGGCGCCCGACGACTACGGCAGCGGCGATGAGC
AGCGTGCGGACGGCGAGCACGTAACGGCCCTGACGGAGACGGCGGCGGACGAGGCGGCGGCGCCGTCGACGCAGG
CGATACCGGTAGCCCTGGCCAAGGAAGGCTTCAGCCTCACCATAGCGGACCGATACGCGTGCGCGATGCCGATCC
CGGACAGCTACGGCGCGGCCGAGCATTGGCAGTGGATGGCGACGCTGTGGCGCGGCACGCTGTGTCCGGACCTCA
TCGTCTACGTCACCTCGGGCAGCGGCGACAGCAATGAGCGTAGGACGGTCGAGCTGTCTCGCCGCATGGGGCTCA
TCGTCGTCAAGGTGCCGGCCGGAAAGGGCCTCGACGAGGCGACGGAGAGGAGGCTGGCCTTTGAGGTCATGGAGT
GGATGCGCGAGGGGTCGTTTCGCGAGCCGTTGCCGAGGGATTGGCGGTGGCATATGCCTTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail