Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|6268
Gene name
Locationscaffold_54:39364..40788
Strand-
Gene length (bp)1424
Transcript length (bp)1242
Coding sequence length (bp)1239
Protein length (aa) 413

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00268 Ribonuc_red_sm Ribonucleotide reductase, small chain 1.0E-118 87 355

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q60561|RIR2_MESAU Ribonucleoside-diphosphate reductase subunit M2 OS=Mesocricetus auratus GN=RRM2 PE=2 SV=1 22 387 0.0E+00
sp|Q9C167|RIR2_NEUCR Ribonucleoside-diphosphate reductase small chain OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=rnr-2 PE=3 SV=2 1 413 0.0E+00
sp|P79733|RIR2_DANRE Ribonucleoside-diphosphate reductase subunit M2 OS=Danio rerio GN=rrm2 PE=1 SV=1 1 413 0.0E+00
sp|P09938|RIR2_YEAST Ribonucleoside-diphosphate reductase small chain 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RNR2 PE=1 SV=2 6 413 0.0E+00
sp|Q4R7Q7|RIR2_MACFA Ribonucleoside-diphosphate reductase subunit M2 OS=Macaca fascicularis GN=RRM2 PE=2 SV=1 22 413 0.0E+00
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q60561|RIR2_MESAU Ribonucleoside-diphosphate reductase subunit M2 OS=Mesocricetus auratus GN=RRM2 PE=2 SV=1 22 387 0.0E+00
sp|Q9C167|RIR2_NEUCR Ribonucleoside-diphosphate reductase small chain OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=rnr-2 PE=3 SV=2 1 413 0.0E+00
sp|P79733|RIR2_DANRE Ribonucleoside-diphosphate reductase subunit M2 OS=Danio rerio GN=rrm2 PE=1 SV=1 1 413 0.0E+00
sp|P09938|RIR2_YEAST Ribonucleoside-diphosphate reductase small chain 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RNR2 PE=1 SV=2 6 413 0.0E+00
sp|Q4R7Q7|RIR2_MACFA Ribonucleoside-diphosphate reductase subunit M2 OS=Macaca fascicularis GN=RRM2 PE=2 SV=1 22 413 0.0E+00
sp|P11157|RIR2_MOUSE Ribonucleoside-diphosphate reductase subunit M2 OS=Mus musculus GN=Rrm2 PE=1 SV=1 22 413 0.0E+00
sp|P31350|RIR2_HUMAN Ribonucleoside-diphosphate reductase subunit M2 OS=Homo sapiens GN=RRM2 PE=1 SV=1 22 413 0.0E+00
sp|Q4KLN6|RIR2_RAT Ribonucleoside-diphosphate reductase subunit M2 OS=Rattus norvegicus GN=Rrm2 PE=2 SV=1 22 413 0.0E+00
sp|P36603|RIR2_SCHPO Ribonucleoside-diphosphate reductase small chain OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=suc22 PE=3 SV=2 55 413 3.0E-177
sp|P07201|RIR2_SPISO Ribonucleoside-diphosphate reductase small chain OS=Spisula solidissima PE=2 SV=2 64 413 1.0E-174
sp|Q7LG56|RIR2B_HUMAN Ribonucleoside-diphosphate reductase subunit M2 B OS=Homo sapiens GN=RRM2B PE=1 SV=1 77 391 8.0E-174
sp|Q5R9G0|RIR2B_PONAB Ribonucleoside-diphosphate reductase subunit M2 B OS=Pongo abelii GN=RRM2B PE=2 SV=1 77 391 1.0E-173
sp|Q4R741|RIR2B_MACFA Ribonucleoside-diphosphate reductase subunit M2 B OS=Macaca fascicularis GN=RRM2B PE=2 SV=1 77 391 1.0E-173
sp|Q6PEE3|RIR2B_MOUSE Ribonucleoside-diphosphate reductase subunit M2 B OS=Mus musculus GN=Rrm2b PE=1 SV=1 77 391 5.0E-172
sp|P48592|RIR2_DROME Ribonucleoside-diphosphate reductase subunit M2 OS=Drosophila melanogaster GN=RnrS PE=1 SV=2 12 413 2.0E-171
sp|O57175|RIR2_VACCA Ribonucleoside-diphosphate reductase small chain OS=Vaccinia virus (strain Ankara) GN=MVA032L PE=2 SV=1 78 385 1.0E-167
sp|P29883|RIR2_VACCP Ribonucleoside-diphosphate reductase small chain OS=Vaccinia virus (strain L-IVP) GN=F14 PE=2 SV=1 78 385 2.0E-167
sp|P20493|RIR2_VACCC Ribonucleoside-diphosphate reductase small chain OS=Vaccinia virus (strain Copenhagen) GN=F4L PE=2 SV=1 78 385 3.0E-167
sp|P11158|RIR2_VACCW Ribonucleoside-diphosphate reductase small chain OS=Vaccinia virus (strain Western Reserve) GN=VACWR043 PE=2 SV=1 78 385 7.0E-167
sp|P33799|RIR2_VAR67 Ribonucleoside-diphosphate reductase small chain OS=Variola virus (isolate Human/India/Ind3/1967) GN=C8L PE=2 SV=1 78 385 1.0E-165
sp|P42170|RIR2_CAEEL Ribonucleoside-diphosphate reductase small chain OS=Caenorhabditis elegans GN=rnr-2 PE=3 SV=1 75 386 6.0E-162
sp|P0DKH3|RI2BL_ARATH Ribonucleoside-diphosphate reductase small chain B OS=Arabidopsis thaliana GN=RNR2B PE=2 SV=1 73 391 6.0E-159
sp|Q9DHU2|RIR2_YLDV Ribonucleoside-diphosphate reductase small chain OS=Yaba-like disease virus GN=20L PE=3 SV=1 78 391 1.0E-158
sp|Q9LSD0|RIR2C_ARATH Ribonucleoside-diphosphate reductase small chain C OS=Arabidopsis thaliana GN=TSO2 PE=1 SV=1 73 413 4.0E-156
sp|O46310|RIR2_LEIAM Ribonucleoside-diphosphate reductase small subunit OS=Leishmania amazonensis PE=3 SV=1 67 386 6.0E-155
sp|P50651|RIR2A_ARATH Ribonucleoside-diphosphate reductase small chain A OS=Arabidopsis thaliana GN=RNR2A PE=1 SV=2 75 413 6.0E-154
sp|Q8SRR2|RIR2_ENCCU Ribonucleoside-diphosphate reductase small chain OS=Encephalitozoon cuniculi (strain GB-M1) GN=ECU06_0730 PE=3 SV=1 75 383 2.0E-153
sp|P49730|RIR2_TOBAC Ribonucleoside-diphosphate reductase small chain OS=Nicotiana tabacum PE=2 SV=1 73 413 5.0E-153
sp|P42521|RIR2_DICDI Ribonucleoside-diphosphate reductase small subunit OS=Dictyostelium discoideum GN=rnrB-1 PE=2 SV=2 78 383 6.0E-153
sp|O15910|RIR2_TRYBB Ribonucleoside-diphosphate reductase small chain OS=Trypanosoma brucei brucei GN=RNR2 PE=2 SV=1 51 390 2.0E-152
sp|P32209|RIR2_SWPVK Ribonucleoside-diphosphate reductase small chain OS=Swinepox virus (strain Kasza) GN=C14L PE=3 SV=1 78 348 1.0E-137
sp|P50650|RIR2_PLAF4 Ribonucleoside-diphosphate reductase small chain OS=Plasmodium falciparum (isolate Dd2) GN=RNR2 PE=2 SV=1 72 388 1.0E-137
sp|P50649|RIR2_PLAFG Ribonucleoside-diphosphate reductase small subunit OS=Plasmodium falciparum (isolate FCR-3 / Gambia) GN=RNR2 PE=3 SV=1 80 388 1.0E-129
sp|Q9QTF2|RIR2_RSIV Ribonucleoside-diphosphate reductase small chain OS=Red sea bream iridovirus GN=RR-2 PE=3 SV=1 87 383 1.0E-118
sp|P49723|RIR4_YEAST Ribonucleoside-diphosphate reductase small chain 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RNR4 PE=1 SV=1 71 413 2.0E-116
sp|Q7T6Y9|RIR2_MIMIV Ribonucleoside-diphosphate reductase small chain OS=Acanthamoeba polyphaga mimivirus GN=RNR2 PE=3 SV=2 78 383 4.0E-105
sp|P0C8I0|RIR2_ASFK5 Ribonucleoside-diphosphate reductase small chain OS=African swine fever virus (isolate Pig/Kenya/KEN-50/1950) GN=Ken-056 PE=3 SV=1 78 381 1.0E-70
sp|P0C8I2|RIR2_ASFWA Ribonucleoside-diphosphate reductase small chain OS=African swine fever virus (isolate Warthog/Namibia/Wart80/1980) GN=War-054 PE=3 SV=1 78 381 4.0E-70
sp|P26713|RIR2_ASFM2 Ribonucleoside-diphosphate reductase small chain OS=African swine fever virus (isolate Tick/Malawi/Lil 20-1/1983) GN=Mal-052 PE=3 SV=1 78 381 3.0E-69
sp|P0C8I1|RIR2_ASFP4 Ribonucleoside-diphosphate reductase small chain OS=African swine fever virus (isolate Tick/South Africa/Pretoriuskop Pr4/1996) GN=Pret-056 PE=3 SV=1 78 381 3.0E-69
sp|P42492|RIR2_ASFB7 Ribonucleoside-diphosphate reductase small chain OS=African swine fever virus (strain Badajoz 1971 Vero-adapted) GN=Ba71V-044 PE=3 SV=1 78 381 4.0E-69
sp|P0DKH2|RI2BC_ARATH Putative ribonucleoside-diphosphate reductase small chain B OS=Arabidopsis thaliana GN=RNR2B PE=5 SV=1 73 214 1.0E-61
sp|Q9Z6S4|RIR2_CHLPN Ribonucleoside-diphosphate reductase subunit beta OS=Chlamydia pneumoniae GN=nrdB PE=3 SV=1 90 385 3.0E-36
sp|O84835|RIR2_CHLTR Ribonucleoside-diphosphate reductase subunit beta OS=Chlamydia trachomatis (strain D/UW-3/Cx) GN=nrdB PE=1 SV=1 90 385 1.0E-35
sp|Q9PL92|RIR2_CHLMU Ribonucleoside-diphosphate reductase subunit beta OS=Chlamydia muridarum (strain MoPn / Nigg) GN=nrdB PE=3 SV=1 90 385 3.0E-35
sp|Q6R7K3|RIR2_OSHVF Ribonucleoside-diphosphate reductase small chain OS=Ostreid herpesvirus 1 (isolate France) GN=ORF20 PE=3 SV=1 89 378 3.0E-28
sp|P0CAP6|RIR2_EBVB9 Ribonucleoside-diphosphate reductase small chain OS=Epstein-Barr virus (strain B95-8) GN=BaRF1 PE=1 SV=1 110 378 4.0E-28
sp|P0CAP7|RIR2_EBVA8 Ribonucleoside-diphosphate reductase small chain OS=Epstein-Barr virus (strain AG876) GN=BaRF1 PE=3 SV=1 110 378 4.0E-28
sp|P0C701|RIR2_EBVG Ribonucleoside-diphosphate reductase small chain OS=Epstein-Barr virus (strain GD1) GN=BaRF1 PE=1 SV=1 110 378 4.0E-28
sp|Q77MS0|RIR2_GAHVM Ribonucleoside-diphosphate reductase small chain OS=Gallid herpesvirus 2 (strain Chicken/Md5/ATCC VR-987) GN=MDV053 PE=3 SV=1 110 378 8.0E-27
sp|Q6UDJ1|RIR2_PSHV1 Ribonucleoside-diphosphate reductase small chain OS=Psittacid herpesvirus 1 (isolate Amazon parrot/-/97-0001/1997) GN=UL40 PE=3 SV=1 107 378 3.0E-26
sp|Q4JQV7|RIR2_VZVO Ribonucleoside-diphosphate reductase small chain OS=Varicella-zoster virus (strain Oka vaccine) GN=ORF18 PE=1 SV=1 119 378 1.0E-25
sp|P09247|RIR2_VZVD Ribonucleoside-diphosphate reductase small chain OS=Varicella-zoster virus (strain Dumas) GN=ORF18 PE=3 SV=1 119 378 1.0E-25
sp|P50645|RIR2_SUHVK Ribonucleoside-diphosphate reductase small chain OS=Suid herpesvirus 1 (strain Kaplan) GN=RR2 PE=3 SV=1 107 383 2.0E-24
sp|F5HAW0|RIR2_HHV8P Ribonucleoside-diphosphate reductase small chain OS=Human herpesvirus 8 type P (isolate GK18) GN=ORF60 PE=3 SV=1 100 378 4.0E-24
sp|P50644|RIR2_EHV4 Ribonucleoside-diphosphate reductase small chain OS=Equine herpesvirus 4 (strain 1942) PE=3 SV=1 107 379 6.0E-22
sp|Q66662|RIR2_EHV2 Ribonucleoside-diphosphate reductase small chain OS=Equine herpesvirus 2 (strain 86/87) GN=60 PE=3 SV=1 110 381 1.0E-21
sp|P28847|RIR2_EHV1B Ribonucleoside-diphosphate reductase small chain OS=Equine herpesvirus 1 (strain Ab4p) GN=20 PE=3 SV=1 107 379 2.0E-21
sp|O36410|RIR2_ALHV1 Ribonucleoside-diphosphate reductase small chain OS=Alcelaphine herpesvirus 1 (strain C500) GN=60 PE=3 SV=1 110 378 5.0E-21
sp|Q01319|RIR2_BHV1C Ribonucleoside-diphosphate reductase small chain OS=Bovine herpesvirus 1.1 (strain Cooper) GN=UL40 PE=3 SV=1 107 378 8.0E-21
sp|P69521|RIR2_HHV2H Ribonucleoside-diphosphate reductase small chain OS=Human herpesvirus 2 (strain HG52) GN=UL40 PE=3 SV=1 110 383 7.0E-20
sp|P69520|RIR2_HHV23 Ribonucleoside-diphosphate reductase small chain OS=Human herpesvirus 2 (strain 333) PE=3 SV=1 110 383 7.0E-20
sp|P55983|RIR2_HELPY Ribonucleoside-diphosphate reductase subunit beta OS=Helicobacter pylori (strain ATCC 700392 / 26695) GN=nrdB PE=3 SV=1 84 383 2.0E-19
sp|P10224|RIR2_HHV11 Ribonucleoside-diphosphate reductase small chain OS=Human herpesvirus 1 (strain 17) GN=UL40 PE=3 SV=1 47 383 3.0E-19
sp|Q9ZKC3|RIR2_HELPJ Ribonucleoside-diphosphate reductase subunit beta OS=Helicobacter pylori (strain J99 / ATCC 700824) GN=nrdB PE=3 SV=1 84 383 4.0E-19
sp|P06474|RIR2_HHV1K Ribonucleoside-diphosphate reductase small chain OS=Human herpesvirus 1 (strain KOS) GN=UL40 PE=3 SV=2 47 383 1.0E-18
sp|Q01038|RIR2_SHV21 Ribonucleoside-diphosphate reductase small chain OS=Saimiriine herpesvirus 2 (strain 11) GN=60 PE=3 SV=1 110 378 2.0E-18
sp|Q197B2|RIR2_IIV3 Probable ribonucleoside-diphosphate reductase small subunit 048L OS=Invertebrate iridescent virus 3 GN=IIV3-048L PE=3 SV=1 92 383 3.0E-16
sp|Q91FE8|RIR2_IIV6 Probable ribonucleoside-diphosphate reductase small subunit 376L OS=Invertebrate iridescent virus 6 GN=IIV6-376L PE=3 SV=1 92 378 2.0E-15
sp|O83092|RIR2_TREPA Ribonucleoside-diphosphate reductase subunit beta OS=Treponema pallidum (strain Nichols) GN=nrdB PE=3 SV=1 93 385 1.0E-12
sp|Q6GZQ8|RIR2_FRG3G Putative ribonucleoside-diphosphate reductase small subunit 067L OS=Frog virus 3 (isolate Goorha) GN=FV3-067L PE=3 SV=1 92 386 5.0E-12
sp|Q9KFH7|RIR2_BACHD Ribonucleoside-diphosphate reductase subunit beta OS=Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125) GN=nrdB PE=1 SV=1 93 382 1.0E-11
sp|P50621|RIR2_BACSU Ribonucleoside-diphosphate reductase subunit beta OS=Bacillus subtilis (strain 168) GN=nrdF PE=1 SV=1 102 383 5.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0009263 deoxyribonucleotide biosynthetic process Yes
GO:0046483 heterocycle metabolic process No
GO:0009987 cellular process No
GO:0071704 organic substance metabolic process No
GO:0009165 nucleotide biosynthetic process No
GO:0006793 phosphorus metabolic process No
GO:0044237 cellular metabolic process No
GO:0008152 metabolic process No
GO:0006139 nucleobase-containing compound metabolic process No
GO:1901576 organic substance biosynthetic process No
GO:1901293 nucleoside phosphate biosynthetic process No
GO:0044238 primary metabolic process No
GO:0006796 phosphate-containing compound metabolic process No
GO:0018130 heterocycle biosynthetic process No
GO:0006725 cellular aromatic compound metabolic process No
GO:0008150 biological_process No
GO:0044281 small molecule metabolic process No
GO:1901362 organic cyclic compound biosynthetic process No
GO:0009117 nucleotide metabolic process No
GO:0009058 biosynthetic process No
GO:0044249 cellular biosynthetic process No
GO:0006753 nucleoside phosphate metabolic process No
GO:0034641 cellular nitrogen compound metabolic process No
GO:0090407 organophosphate biosynthetic process No
GO:0006807 nitrogen compound metabolic process No
GO:0009262 deoxyribonucleotide metabolic process No
GO:0019438 aromatic compound biosynthetic process No
GO:1901135 carbohydrate derivative metabolic process No
GO:0034654 nucleobase-containing compound biosynthetic process No
GO:1901360 organic cyclic compound metabolic process No
GO:0019637 organophosphate metabolic process No
GO:1901137 carbohydrate derivative biosynthetic process No
GO:0044271 cellular nitrogen compound biosynthetic process No
GO:0055086 nucleobase-containing small molecule metabolic process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)		 D score
(significance: > 0.45)
No 1 - 47 0.45

Transmembrane Domains

Domain # Start End Length
1 233 255 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|6268
MTAHVTPSKQAASAIESLKMESPIKKLDFGAADKENRPLDQSADADAASDLAPKDTKDGKKDSKPDVATGIKPEE
ADEPLLQENPQRFVLFPIKYHEIWAMYKKAEASFWTAEEIDLSKDLHDWNNRINDDEKYFISHILAFFAASDGIV
NENLVERFSGEVQIPEARCFYGFQIMMENIHSETYSLLIDTYIKEHAQRTYLFNAIETIPCIRKKADWAIRWIQD
KDSSFAQRLVAFAAVEGIFFSGAFASIFWLKKRGLMPGLTFSNELISRDEGLHTDFACLLHSHLKTRASKEVIRG
IITDAVTIEQEFLTEALPCGLLGMNATLMKQYIEFVADRLLVALGNDKVYKSANPFDFMENISLGGKTNFFEKRV
ADYQKAGVMASTKKNADDGAASTDNKGEGGDFTFDDDF
Coding >Ophio5|6268
ATGACTGCTCACGTCACCCCGTCTAAGCAGGCTGCCTCGGCCATTGAGTCGCTCAAGATGGAGTCGCCCATCAAG
AAACTCGACTTTGGTGCCGCTGATAAGGAGAATCGGCCCCTGGACCAGTCTGCCGATGCCGACGCCGCATCGGAC
CTTGCCCCCAAGGATACCAAGGACGGCAAGAAAGACAGCAAGCCTGATGTCGCTACCGGCATCAAGCCCGAAGAG
GCCGACGAGCCTCTTCTGCAGGAGAATCCCCAGCGCTTTGTCCTGTTTCCCATCAAGTACCACGAGATTTGGGCC
ATGTACAAAAAAGCAGAGGCCTCCTTCTGGACAGCTGAAGAGATTGACCTATCCAAGGACCTGCACGACTGGAAC
AATCGCATCAATGACGACGAAAAGTACTTCATCTCCCACATTCTCGCCTTCTTTGCCGCCTCGGACGGCATCGTC
AACGAGAACCTCGTAGAGAGATTCAGCGGCGAAGTCCAGATCCCCGAGGCCCGGTGCTTCTACGGATTCCAAATC
ATGATGGAAAACATCCACTCCGAGACGTACTCGCTCTTGATCGACACATACATCAAGGAGCACGCCCAACGGACC
TATCTCTTCAACGCCATCGAGACCATTCCCTGCATTCGCAAAAAGGCCGATTGGGCCATCCGCTGGATTCAGGAC
AAGGATTCGTCGTTCGCTCAACGTCTGGTGGCCTTTGCCGCCGTTGAGGGCATCTTTTTCAGCGGAGCTTTCGCC
TCCATTTTCTGGCTCAAGAAGCGCGGGCTCATGCCTGGCCTGACTTTTTCCAACGAGCTCATCTCGCGGGATGAG
GGTCTGCACACAGACTTTGCCTGCCTGCTGCACTCTCACCTGAAGACACGGGCCAGCAAAGAGGTCATTCGAGGC
ATCATCACCGACGCCGTCACCATTGAACAGGAGTTCCTGACCGAGGCCCTTCCCTGCGGTCTGCTCGGCATGAAC
GCTACCCTGATGAAGCAGTACATTGAATTTGTCGCCGATCGCCTGCTTGTCGCTCTCGGCAATGACAAGGTCTAC
AAGTCTGCCAACCCCTTCGACTTTATGGAGAATATCTCTCTCGGCGGCAAGACCAACTTCTTCGAGAAGCGCGTC
GCCGACTACCAGAAGGCCGGCGTCATGGCCAGCACAAAAAAGAATGCCGACGATGGTGCCGCTTCGACGGACAAC
AAGGGCGAGGGCGGCGACTTCACATTTGACGACGACTTT
Transcript >Ophio5|6268
ATGACTGCTCACGTCACCCCGTCTAAGCAGGCTGCCTCGGCCATTGAGTCGCTCAAGATGGAGTCGCCCATCAAG
AAACTCGACTTTGGTGCCGCTGATAAGGAGAATCGGCCCCTGGACCAGTCTGCCGATGCCGACGCCGCATCGGAC
CTTGCCCCCAAGGATACCAAGGACGGCAAGAAAGACAGCAAGCCTGATGTCGCTACCGGCATCAAGCCCGAAGAG
GCCGACGAGCCTCTTCTGCAGGAGAATCCCCAGCGCTTTGTCCTGTTTCCCATCAAGTACCACGAGATTTGGGCC
ATGTACAAAAAAGCAGAGGCCTCCTTCTGGACAGCTGAAGAGATTGACCTATCCAAGGACCTGCACGACTGGAAC
AATCGCATCAATGACGACGAAAAGTACTTCATCTCCCACATTCTCGCCTTCTTTGCCGCCTCGGACGGCATCGTC
AACGAGAACCTCGTAGAGAGATTCAGCGGCGAAGTCCAGATCCCCGAGGCCCGGTGCTTCTACGGATTCCAAATC
ATGATGGAAAACATCCACTCCGAGACGTACTCGCTCTTGATCGACACATACATCAAGGAGCACGCCCAACGGACC
TATCTCTTCAACGCCATCGAGACCATTCCCTGCATTCGCAAAAAGGCCGATTGGGCCATCCGCTGGATTCAGGAC
AAGGATTCGTCGTTCGCTCAACGTCTGGTGGCCTTTGCCGCCGTTGAGGGCATCTTTTTCAGCGGAGCTTTCGCC
TCCATTTTCTGGCTCAAGAAGCGCGGGCTCATGCCTGGCCTGACTTTTTCCAACGAGCTCATCTCGCGGGATGAG
GGTCTGCACACAGACTTTGCCTGCCTGCTGCACTCTCACCTGAAGACACGGGCCAGCAAAGAGGTCATTCGAGGC
ATCATCACCGACGCCGTCACCATTGAACAGGAGTTCCTGACCGAGGCCCTTCCCTGCGGTCTGCTCGGCATGAAC
GCTACCCTGATGAAGCAGTACATTGAATTTGTCGCCGATCGCCTGCTTGTCGCTCTCGGCAATGACAAGGTCTAC
AAGTCTGCCAACCCCTTCGACTTTATGGAGAATATCTCTCTCGGCGGCAAGACCAACTTCTTCGAGAAGCGCGTC
GCCGACTACCAGAAGGCCGGCGTCATGGCCAGCACAAAAAAGAATGCCGACGATGGTGCCGCTTCGACGGACAAC
AAGGGCGAGGGCGGCGACTTCACATTTGACGACGACTTTTGA
Gene >Ophio5|6268
ATGACTGCTCACGTCACCCCGTCTAAGCAGGTGAGTGGCGTTGCCTCTCGTCGCCCTGCTGTCGACTGACCGCGT
CTGCCACCAGGCTGCCTCGGCCATTGAGTCGCTCAAGATGGAGTCGCCCATCAAGAAACTCGACTTTGGTGCCGC
TGATAAGGAGAATCGGCCCCTGGACCAGTCTGCCGATGCCGACGCCGCATCGGACCTTGCCCCCAAGGATACCAA
GGACGGCAAGAAAGACAGCAAGCCTGATGTCGCTACCGGCATCAAGCCCGAAGAGGCCGACGAGCCTCTTCTGCA
GGAGAATCCCCAGCGCTTTGTCCTGTTTCCCATCAAGTACCACGAGGTTGGTGGCGTGTCCTTGACGCGCAAAGT
ACTTCCTTCACCCGCTGACGACCCCTCCCTTGTGTCCAGATTTGGGCCATGTACAAAAAAGCAGAGGCCTCCTTC
TGGACAGCTGAAGAGATTGACCTATCCAAGGACCTGCACGACTGGAACAATCGCATCAATGACGACGAAAAGTAC
TTCATCTCCCACATTCTCGCCTTCTTTGCCGCCTCGGACGGCATCGTCAACGAGAACCTCGTAGAGAGATTCAGC
GGCGAAGTCCAGATCCCCGAGGCCCGGTGCTTCTACGGATTCCAAATCATGATGGAAAACATCCACTCCGAGACG
TACTCGCTCTTGATCGACACATACATCAAGGAGCACGCCCAACGGACCTATCTCTTCAACGCCATCGAGACCAGT
ATGCCGTCCTGTCGAGTGTCCCACGTTGCGCGCACCAGCTGCTGACGGAAGGAATAGTTCCCTGCATTCGCAAAA
AGGCCGATTGGGCCATCCGCTGGATTCAGGACAAGGATTCGTCGTTCGCTCAACGTCTGGTGGCCTTTGCCGCCG
TTGAGGGCATCTTTTTCAGCGGAGCTTTCGCCTCCATTTTCTGGCTCAAGAAGCGCGGGCTCATGCCTGGCCTGA
CTTTTTCCAACGAGCTCATCTCGCGGGATGAGGGTCTGCACACAGACTTTGCCTGCCTGCTGCACTCTCACCTGA
AGACACGGGCCAGCAAAGAGGTCATTCGAGGCATCATCACCGACGCCGTCACCATTGAACAGGAGTTCCTGACCG
AGGCCCTTCCCTGCGGTCTGCTCGGCATGAACGCTACCCTGATGAAGCAGTACATTGAATTTGTCGCCGATCGCC
TGCTTGTCGCTCTCGGCAATGACAAGGTCTACAAGTCTGCCAACCCCTTCGACTTTATGGAGAATATCTCTCTCG
GCGGCAAGACCAACTTCTTCGAGAAGCGCGTCGCCGACTACCAGAAGGCCGGCGTCATGGCCAGCACAAAAAAGA
ATGCCGACGATGGTGCCGCTTCGACGGACAACAAGGGCGAGGGCGGCGACTTCACATTTGACGACGACTTTTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail