Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|6267
Gene name
Locationscaffold_54:38374..38970
Strand+
Gene length (bp)596
Transcript length (bp)489
Coding sequence length (bp)486
Protein length (aa) 162

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF05486 SRP9-21 Signal recognition particle 9 kDa protein (SRP9) 4.6E-32 4 99

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|O13804|YE07_SCHPO Uncharacterized protein C17H9.07 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC17H9.07 PE=4 SV=1 1 88 3.0E-07

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Nucleus Nuclear localization signal 0.428 0.7585 0.046 0.036 0.0914 0.0032 0.1366 0.0129 0.2192 0.0271

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup5284
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|2339
Ophiocordyceps australis map64 (Brazil) OphauB2|816
Ophiocordyceps camponoti-floridani Ophcf2|05662
Ophiocordyceps camponoti-rufipedis Ophun1|818
Ophiocordyceps kimflemingae Ophio5|6267 (this protein)
Ophiocordyceps subramaniannii Hirsu2|4704

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|6267
MPYFHSSQEWLEQSVLLVEARPSTTRITTRYSIKAVKPFVEKKAAGDQDVTPTTRPPRARLVLKTFDPVSGVTLK
YRTTKAAEVSRLVHASLGTVARAMAALPATAADSVQEESVLDAQPAAPDAPTATTSREAKAVQGLSSRQQPQQQT
AGAGHKKKKGRK
Coding >Ophio5|6267
ATGCCCTACTTCCATTCGAGTCAGGAGTGGCTCGAGCAATCGGTCCTCCTCGTCGAAGCCCGGCCCTCGACCACG
CGAATCACGACCCGCTACTCCATCAAGGCCGTCAAGCCCTTCGTCGAGAAGAAGGCGGCGGGCGACCAAGACGTG
ACGCCTACAACAAGACCGCCACGCGCCCGTCTCGTCCTCAAGACATTCGACCCCGTCAGCGGCGTCACGCTCAAG
TATCGCACCACAAAGGCCGCAGAGGTCTCGCGTCTCGTACACGCGTCCCTCGGCACGGTCGCCAGGGCTATGGCT
GCTCTGCCTGCTACCGCTGCCGATAGTGTCCAAGAGGAGTCTGTGCTGGATGCGCAACCCGCCGCCCCGGATGCG
CCGACCGCGACGACTTCCAGGGAGGCTAAGGCTGTGCAGGGCCTGTCGTCGAGGCAGCAGCCGCAGCAGCAGACG
GCTGGAGCGGGGCACAAGAAGAAGAAAGGCCGCAAA
Transcript >Ophio5|6267
ATGCCCTACTTCCATTCGAGTCAGGAGTGGCTCGAGCAATCGGTCCTCCTCGTCGAAGCCCGGCCCTCGACCACG
CGAATCACGACCCGCTACTCCATCAAGGCCGTCAAGCCCTTCGTCGAGAAGAAGGCGGCGGGCGACCAAGACGTG
ACGCCTACAACAAGACCGCCACGCGCCCGTCTCGTCCTCAAGACATTCGACCCCGTCAGCGGCGTCACGCTCAAG
TATCGCACCACAAAGGCCGCAGAGGTCTCGCGTCTCGTACACGCGTCCCTCGGCACGGTCGCCAGGGCTATGGCT
GCTCTGCCTGCTACCGCTGCCGATAGTGTCCAAGAGGAGTCTGTGCTGGATGCGCAACCCGCCGCCCCGGATGCG
CCGACCGCGACGACTTCCAGGGAGGCTAAGGCTGTGCAGGGCCTGTCGTCGAGGCAGCAGCCGCAGCAGCAGACG
GCTGGAGCGGGGCACAAGAAGAAGAAAGGCCGCAAATGA
Gene >Ophio5|6267
ATGCCCTACTTCCATTCGAGTCAGGAGTGGCTCGAGCAATCGGTCCTCCTCGTCGAAGCCCGGCCCTCGACCGTA
ACCCCCCCCCCCCCCCCCTTTCCCCTCCTCGTTCCTTCACCATGGATACCATGGAGTAAGGAGAAAACAAAAAAA
AAAAAACAGCCGGTTGACGGTATTTCCAGACGCGAATCACGACCCGCTACTCCATCAAGGCCGTCAAGCCCTTCG
TCGAGAAGAAGGCGGCGGGCGACCAAGACGTGACGCCTACAACAAGACCGCCACGCGCCCGTCTCGTCCTCAAGA
CATTCGACCCCGTCAGCGGCGTCACGCTCAAGTATCGCACCACAAAGGCCGCAGAGGTCTCGCGTCTCGTACACG
CGTCCCTCGGCACGGTCGCCAGGGCTATGGCTGCTCTGCCTGCTACCGCTGCCGATAGTGTCCAAGAGGAGTCTG
TGCTGGATGCGCAACCCGCCGCCCCGGATGCGCCGACCGCGACGACTTCCAGGGAGGCTAAGGCTGTGCAGGGCC
TGTCGTCGAGGCAGCAGCCGCAGCAGCAGACGGCTGGAGCGGGGCACAAGAAGAAGAAAGGCCGCAAATGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail