Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|6252
Gene name
Locationscaffold_539:12020..12719
Strand-
Gene length (bp)699
Transcript length (bp)636
Coding sequence length (bp)633
Protein length (aa) 211

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF06984 MRP-L47 Mitochondrial 39-S ribosomal protein L47 (MRP-L47) 7.7E-20 77 168

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q2H080|RM04_CHAGB 54S ribosomal protein L4, mitochondrial OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=MRPL4 PE=3 SV=1 14 198 1.0E-52
sp|Q7S910|RM04_NEUCR 54S ribosomal protein L4, mitochondrial OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=mrpl-4 PE=3 SV=2 14 199 6.0E-52
sp|A6SLT9|RM04_BOTFB 54S ribosomal protein L4, mitochondrial OS=Botryotinia fuckeliana (strain B05.10) GN=mrpl4 PE=3 SV=1 32 197 3.0E-44
sp|A4RHR8|RM04_MAGO7 54S ribosomal protein L4, mitochondrial OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=MRPL4 PE=3 SV=1 28 204 4.0E-42
sp|A1C6F8|RM04_ASPCL 54S ribosomal protein L4, mitochondrial OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=mrpl4 PE=3 SV=1 3 180 1.0E-40
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q2H080|RM04_CHAGB 54S ribosomal protein L4, mitochondrial OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=MRPL4 PE=3 SV=1 14 198 1.0E-52
sp|Q7S910|RM04_NEUCR 54S ribosomal protein L4, mitochondrial OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=mrpl-4 PE=3 SV=2 14 199 6.0E-52
sp|A6SLT9|RM04_BOTFB 54S ribosomal protein L4, mitochondrial OS=Botryotinia fuckeliana (strain B05.10) GN=mrpl4 PE=3 SV=1 32 197 3.0E-44
sp|A4RHR8|RM04_MAGO7 54S ribosomal protein L4, mitochondrial OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=MRPL4 PE=3 SV=1 28 204 4.0E-42
sp|A1C6F8|RM04_ASPCL 54S ribosomal protein L4, mitochondrial OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=mrpl4 PE=3 SV=1 3 180 1.0E-40
sp|Q0CXX1|RM04_ASPTN 54S ribosomal protein L4, mitochondrial OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=mrpl4 PE=3 SV=1 3 180 2.0E-40
sp|Q4X156|RM04_ASPFU 54S ribosomal protein L4, mitochondrial OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=mrpl4 PE=3 SV=1 3 181 6.0E-40
sp|A1DH31|RM04_NEOFI 54S ribosomal protein L4, mitochondrial OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=mrpl4 PE=3 SV=1 3 175 3.0E-39
sp|Q5B0N3|RM04_EMENI 54S ribosomal protein L4, mitochondrial OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=mrpl4 PE=3 SV=1 3 181 4.0E-39
sp|A2QCC7|RM04_ASPNC 54S ribosomal protein L4, mitochondrial OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=mrpl4 PE=3 SV=1 3 181 8.0E-39
sp|Q1DNY5|RM04_COCIM 54S ribosomal protein L4, mitochondrial OS=Coccidioides immitis (strain RS) GN=MRPL4 PE=3 SV=1 6 175 4.0E-38
sp|A7EWR0|RM04_SCLS1 54S ribosomal protein L4, mitochondrial OS=Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1) GN=MRPL4 PE=3 SV=1 69 197 2.0E-37
sp|Q0U6J9|RM04_PHANO 54S ribosomal protein L4, mitochondrial OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) GN=MRPL4 PE=3 SV=2 14 192 1.0E-36
sp|A6RDX3|RM04_AJECN 54S ribosomal protein L4, mitochondrial OS=Ajellomyces capsulatus (strain NAm1 / WU24) GN=MRPL4 PE=3 SV=1 20 177 3.0E-35
sp|Q6CF20|RM04_YARLI 54S ribosomal protein L4, mitochondrial OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=MRPL4 PE=3 SV=1 50 189 3.0E-17
sp|A5E713|RM04_LODEL 54S ribosomal protein L4, mitochondrial OS=Lodderomyces elongisporus (strain ATCC 11503 / CBS 2605 / JCM 1781 / NBRC 1676 / NRRL YB-4239) GN=MRPL4 PE=3 SV=1 38 173 5.0E-17
sp|Q59RP7|RM04_CANAL 54S ribosomal protein L4, mitochondrial OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=MRPL4 PE=3 SV=1 42 188 5.0E-16
sp|P87232|RM04_SCHPO 54S ribosomal protein L4, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mrpl4 PE=3 SV=1 55 181 9.0E-16
sp|A3LYY9|RM04_PICST 54S ribosomal protein L4, mitochondrial OS=Scheffersomyces stipitis (strain ATCC 58785 / CBS 6054 / NBRC 10063 / NRRL Y-11545) GN=MRPL4 PE=3 SV=2 45 173 3.0E-14
sp|Q756Y8|RM04_ASHGO 54S ribosomal protein L4, mitochondrial OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=MRPL4 PE=3 SV=3 68 168 3.0E-14
sp|A5DH98|RM04_PICGU 54S ribosomal protein L4, mitochondrial OS=Meyerozyma guilliermondii (strain ATCC 6260 / CBS 566 / DSM 6381 / JCM 1539 / NBRC 10279 / NRRL Y-324) GN=MRPL4 PE=3 SV=2 59 173 4.0E-13
sp|Q6FK61|RM04_CANGA 54S ribosomal protein L4, mitochondrial OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=MRPL4 PE=3 SV=1 75 185 5.0E-13
sp|Q6CWC4|RM04_KLULA 54S ribosomal protein L4, mitochondrial OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=MRPL4 PE=3 SV=1 75 168 8.0E-13
sp|A7TNQ2|RM04_VANPO 54S ribosomal protein L4, mitochondrial OS=Vanderwaltozyma polyspora (strain ATCC 22028 / DSM 70294) GN=MRPL4 PE=3 SV=1 57 178 2.0E-12
sp|P36517|RM04_YEAST 54S ribosomal protein L4, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MRPL4 PE=1 SV=2 75 172 8.0E-12
sp|A7A1V9|RM04_YEAS7 54S ribosomal protein L4, mitochondrial OS=Saccharomyces cerevisiae (strain YJM789) GN=MRPL4 PE=3 SV=1 75 172 8.0E-12
sp|Q6BQK3|RM04_DEBHA 54S ribosomal protein L4, mitochondrial OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=MRPL4 PE=3 SV=2 43 173 3.0E-11
sp|Q9HD33|RM47_HUMAN 39S ribosomal protein L47, mitochondrial OS=Homo sapiens GN=MRPL47 PE=1 SV=2 76 177 1.0E-08
sp|Q08DT6|RM47_BOVIN 39S ribosomal protein L47, mitochondrial OS=Bos taurus GN=MRPL47 PE=2 SV=1 75 177 2.0E-08
sp|Q8K2Y7|RM47_MOUSE 39S ribosomal protein L47, mitochondrial OS=Mus musculus GN=Mrpl47 PE=1 SV=2 76 177 8.0E-08
[Show less]

GO

GO Term Description Terminal node
GO:0003735 structural constituent of ribosome Yes
GO:0006412 translation Yes
GO:0005761 mitochondrial ribosome Yes
GO:0044238 primary metabolic process No
GO:0005840 ribosome No
GO:0044260 cellular macromolecule metabolic process No
GO:0003674 molecular_function No
GO:0044237 cellular metabolic process No
GO:0008152 metabolic process No
GO:0043226 organelle No
GO:1901576 organic substance biosynthetic process No
GO:0006518 peptide metabolic process No
GO:0034645 cellular macromolecule biosynthetic process No
GO:1901566 organonitrogen compound biosynthetic process No
GO:0043228 non-membrane-bounded organelle No
GO:0043232 intracellular non-membrane-bounded organelle No
GO:1901564 organonitrogen compound metabolic process No
GO:0008150 biological_process No
GO:0043170 macromolecule metabolic process No
GO:0009059 macromolecule biosynthetic process No
GO:0044249 cellular biosynthetic process No
GO:0000313 organellar ribosome No
GO:0034641 cellular nitrogen compound metabolic process No
GO:0043604 amide biosynthetic process No
GO:0006807 nitrogen compound metabolic process No
GO:0043043 peptide biosynthetic process No
GO:0005198 structural molecule activity No
GO:0005575 cellular_component No
GO:0071704 organic substance metabolic process No
GO:0043229 intracellular organelle No
GO:0019538 protein metabolic process No
GO:0044271 cellular nitrogen compound biosynthetic process No
GO:0043603 cellular amide metabolic process No
GO:0009987 cellular process No
GO:0110165 cellular anatomical entity No
GO:0009058 biosynthetic process No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Mitochondrion Mitochondrial transit peptide 0.155 0.1483 0.0207 0.0868 0.8931 0.048 0.0293 0.0306 0.0335 0.0075

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup5157
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|6109
Ophiocordyceps australis map64 (Brazil) OphauB2|3552
Ophiocordyceps camponoti-floridani Ophcf2|04165
Ophiocordyceps camponoti-rufipedis Ophun1|2074
Ophiocordyceps kimflemingae Ophio5|6252 (this protein)
Ophiocordyceps subramaniannii Hirsu2|3642

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|6252
MTAPSPLFLPDPSSTRAAWFSTTTRRCKRVTRDNNKKRGVSALYRSGPKEFLASSAIKLPTPSDFVPHVEMDKSH
GLWGFFPEPGKLLMTCDELEHYGRAWTVEELRKKSWEDLHSLWWVCCRQRNMLATSKTELEKGKLGFGSLEIDRR
DSEIVKTMKAIKHALTQRYYTWEDALQAAKKDPEIDLDAKDGNVYKPAVRQDSGGIDNGWT
Coding >Ophio5|6252
ATGACGGCCCCCTCCCCTCTGTTTCTGCCCGACCCGTCGTCGACGAGGGCGGCATGGTTCTCGACCACGACCCGG
CGATGCAAGCGCGTAACCAGGGATAACAACAAGAAGCGTGGCGTCAGTGCCCTGTACAGGTCCGGGCCCAAGGAG
TTTCTCGCCTCGTCGGCCATTAAGCTGCCCACACCAAGCGACTTCGTGCCTCATGTGGAGATGGACAAGAGCCAC
GGTTTGTGGGGATTTTTCCCCGAGCCGGGCAAGCTGCTCATGACATGCGATGAGCTAGAGCACTACGGAAGAGCA
TGGACGGTGGAGGAGCTCCGCAAGAAGTCGTGGGAAGACTTGCATTCGCTGTGGTGGGTTTGCTGCAGGCAGCGA
AACATGCTGGCAACCTCCAAGACGGAGCTGGAGAAAGGGAAACTCGGCTTCGGCTCGCTCGAAATTGATCGACGG
GATAGCGAGATTGTCAAGACGATGAAGGCTATCAAGCACGCGCTGACGCAGCGATATTACACGTGGGAGGATGCC
TTACAGGCTGCCAAAAAGGACCCGGAGATTGATCTGGATGCTAAAGACGGCAACGTGTACAAGCCGGCCGTACGG
CAGGACAGCGGCGGAATCGATAATGGGTGGACC
Transcript >Ophio5|6252
ATGACGGCCCCCTCCCCTCTGTTTCTGCCCGACCCGTCGTCGACGAGGGCGGCATGGTTCTCGACCACGACCCGG
CGATGCAAGCGCGTAACCAGGGATAACAACAAGAAGCGTGGCGTCAGTGCCCTGTACAGGTCCGGGCCCAAGGAG
TTTCTCGCCTCGTCGGCCATTAAGCTGCCCACACCAAGCGACTTCGTGCCTCATGTGGAGATGGACAAGAGCCAC
GGTTTGTGGGGATTTTTCCCCGAGCCGGGCAAGCTGCTCATGACATGCGATGAGCTAGAGCACTACGGAAGAGCA
TGGACGGTGGAGGAGCTCCGCAAGAAGTCGTGGGAAGACTTGCATTCGCTGTGGTGGGTTTGCTGCAGGCAGCGA
AACATGCTGGCAACCTCCAAGACGGAGCTGGAGAAAGGGAAACTCGGCTTCGGCTCGCTCGAAATTGATCGACGG
GATAGCGAGATTGTCAAGACGATGAAGGCTATCAAGCACGCGCTGACGCAGCGATATTACACGTGGGAGGATGCC
TTACAGGCTGCCAAAAAGGACCCGGAGATTGATCTGGATGCTAAAGACGGCAACGTGTACAAGCCGGCCGTACGG
CAGGACAGCGGCGGAATCGATAATGGGTGGACCTAG
Gene >Ophio5|6252
ATGACGGCCCCCTCCCCTCTGTTTCTGCCCGACCCGTCGTCGACGAGGGCGGCATGGTTCTCGACCACGACCCGG
CGATGCAAGCGCGTAACCAGGGATAACAACAAGAAGCGTGGCGTCAGTGCCCTGTACAGGTCCGGGCCCAAGGAG
TTTCTCGCCTCGTCGGCCATTAAGCTGCCCACACCAAGCGACTTCGTGCCTCATGTGGAGATGGACAAGAGCCAC
GGTTTGTGGGGATTTTTCCCCGAGCCGGGCAAGCTGCTCATGACATGCGATGAGCTAGAGCACTACGGAAGAGCA
TGGACGGTGGAGGAGCTCCGCAAGAAGTCGTGGGAAGACTTGCATTCGCTGTGGTGGGTTTGCTGCAGGCAGCGA
AACATGCTGGCAACCTCCAAGACGGAGCTGGAGAAAGGGAAACTCGGCTTCGGCTCGCTCGAAATTGATCGACGG
GATAGCGAGGTTTGCGACGCTGCCCATGCTTTCTCATCGGGCAAGAAAAAAAGACTGACAAGAGCGCGGCAGATT
GTCAAGACGATGAAGGCTATCAAGCACGCGCTGACGCAGCGATATTACACGTGGGAGGATGCCTTACAGGCTGCC
AAAAAGGACCCGGAGATTGATCTGGATGCTAAAGACGGCAACGTGTACAAGCCGGCCGTACGGCAGGACAGCGGC
GGAATCGATAATGGGTGGACCTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail