Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|6249
Gene name
Locationscaffold_539:4151..5461
Strand-
Gene length (bp)1310
Transcript length (bp)1254
Coding sequence length (bp)1251
Protein length (aa) 417

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF09668 Asp_protease Aspartyl protease 2.9E-60 164 287
PF13975 gag-asp_proteas gag-polyprotein putative aspartyl protease 5.5E-24 190 281
PF13650 Asp_protease_2 Aspartyl protease 4.3E-12 190 277
PF00627 UBA UBA/TS-N domain 1.3E-06 381 414
PF00240 ubiquitin Ubiquitin family 1.2E-06 2 54
PF00077 RVP Retroviral aspartyl protease 1.2E-04 190 286
PF08284 RVP_2 Retroviral aspartyl protease 3.5E-04 189 296

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q7S906|DDI1_NEUCR DNA damage-inducible protein 1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=ddi-1 PE=3 SV=2 1 416 1.0E-159
sp|Q2H085|DDI1_CHAGB DNA damage-inducible protein 1 OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=DDI1 PE=3 SV=2 1 416 1.0E-158
sp|Q2USD7|DDI1_ASPOR DNA damage-inducible protein 1 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=ddi1 PE=3 SV=2 1 416 2.0E-127
sp|Q5AY89|DDI1_EMENI DNA damage-inducible protein 1 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=ddi1 PE=3 SV=2 1 416 4.0E-125
sp|Q0CJ13|DDI1_ASPTN DNA damage-inducible protein 1 OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=ddi1 PE=3 SV=1 1 416 2.0E-124
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q7S906|DDI1_NEUCR DNA damage-inducible protein 1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=ddi-1 PE=3 SV=2 1 416 1.0E-159
sp|Q2H085|DDI1_CHAGB DNA damage-inducible protein 1 OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=DDI1 PE=3 SV=2 1 416 1.0E-158
sp|Q2USD7|DDI1_ASPOR DNA damage-inducible protein 1 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=ddi1 PE=3 SV=2 1 416 2.0E-127
sp|Q5AY89|DDI1_EMENI DNA damage-inducible protein 1 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=ddi1 PE=3 SV=2 1 416 4.0E-125
sp|Q0CJ13|DDI1_ASPTN DNA damage-inducible protein 1 OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=ddi1 PE=3 SV=1 1 416 2.0E-124
sp|A1DCU5|DDI1_NEOFI DNA damage-inducible protein 1 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=ddi1 PE=3 SV=1 1 416 3.0E-124
sp|Q4WGS4|DDI1_ASPFU DNA damage-inducible protein 1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=ddi1 PE=3 SV=1 1 416 4.0E-123
sp|Q0U3Y6|DDI1_PHANO DNA damage-inducible protein 1 OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) GN=DDI1 PE=3 SV=2 2 416 4.0E-120
sp|Q1DNB9|DDI1_COCIM DNA damage-inducible protein 1 OS=Coccidioides immitis (strain RS) GN=DDI1 PE=3 SV=3 1 416 6.0E-119
sp|A1CDT9|DDI1_ASPCL DNA damage-inducible protein 1 OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=ddi1 PE=3 SV=1 1 416 9.0E-119
sp|P0CS14|DDI1_CRYNJ DNA damage-inducible protein 1 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=DDI1 PE=3 SV=1 83 416 1.0E-100
sp|P0CS15|DDI1_CRYNB DNA damage-inducible protein 1 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=DDI1 PE=3 SV=1 83 416 1.0E-100
sp|Q10256|MUD1_SCHPO UBA domain-containing protein mud1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mud1 PE=1 SV=1 86 416 1.0E-86
sp|Q5TDH0|DDI2_HUMAN Protein DDI1 homolog 2 OS=Homo sapiens GN=DDI2 PE=1 SV=1 3 310 4.0E-72
sp|Q6BK42|DDI1_DEBHA DNA damage-inducible protein 1 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=DDI1 PE=3 SV=2 1 416 7.0E-71
sp|A2ADY9|DDI2_MOUSE Protein DDI1 homolog 2 OS=Mus musculus GN=Ddi2 PE=1 SV=1 3 310 2.0E-70
sp|Q6FQE9|DDI1_CANGA DNA damage-inducible protein 1 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=DDI1 PE=3 SV=1 1 416 6.0E-70
sp|Q6CFI3|DDI1_YARLI DNA damage-inducible protein 1 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=DDI1 PE=3 SV=1 1 416 9.0E-70
sp|Q7ZYA7|DDI2_XENLA Protein DDI1 homolog 2 OS=Xenopus laevis GN=ddi2 PE=2 SV=1 3 310 2.0E-68
sp|Q497D6|DDI2_XENTR Protein DDI1 homolog 2 OS=Xenopus tropicalis GN=ddi2 PE=2 SV=1 3 310 2.0E-67
sp|Q6TH22|DDI2_DANRE Protein DDI1 homolog 2 OS=Danio rerio GN=ddi2 PE=2 SV=1 11 310 4.0E-66
sp|Q8WTU0|DDI1_HUMAN Protein DDI1 homolog 1 OS=Homo sapiens GN=DDI1 PE=1 SV=1 3 309 5.0E-63
sp|Q2T9Z1|DDI1_BOVIN Protein DDI1 homolog 1 OS=Bos taurus GN=DDI1 PE=2 SV=1 12 309 5.0E-63
sp|P40087|DDI1_YEAST DNA damage-inducible protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DDI1 PE=1 SV=1 1 416 2.0E-62
sp|A0JPP7|DDI1_RAT Protein DDI1 homolog 1 OS=Rattus norvegicus GN=Ddi1 PE=1 SV=1 3 309 5.0E-62
sp|Q95JI3|DDI1_MACFA Protein DDI1 homolog 1 OS=Macaca fascicularis GN=DDI1 PE=2 SV=1 3 309 2.0E-61
sp|Q9DAF3|DDI1_MOUSE Protein DDI1 homolog 1 OS=Mus musculus GN=Ddi1 PE=1 SV=1 3 329 7.0E-61
sp|Q6CNS3|DDI1_KLULA DNA damage-inducible protein 1 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=DDI1 PE=3 SV=1 20 416 4.0E-60
sp|Q54JB0|DDI1_DICDI Protein DDI1 homolog OS=Dictyostelium discoideum GN=ddi1 PE=3 SV=1 2 416 3.0E-59
sp|Q754R2|DDI1_ASHGO DNA damage-inducible protein 1 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=DDI1 PE=3 SV=1 73 416 2.0E-58
sp|Q9JJR9|NRIP3_MOUSE Nuclear receptor-interacting protein 3 OS=Mus musculus GN=Nrip3 PE=1 SV=1 187 303 1.0E-09
sp|Q9NQ35|NRIP3_HUMAN Nuclear receptor-interacting protein 3 OS=Homo sapiens GN=NRIP3 PE=1 SV=1 187 303 5.0E-08
sp|Q5R7G1|NRIP3_PONAB Nuclear receptor-interacting protein 3 OS=Pongo abelii GN=NRIP3 PE=2 SV=1 187 303 8.0E-07
[Show less]

GO

GO Term Description Terminal node
GO:0005515 protein binding Yes
GO:0006508 proteolysis Yes
GO:0004190 aspartic-type endopeptidase activity Yes
GO:0008233 peptidase activity No
GO:0043170 macromolecule metabolic process No
GO:0008150 biological_process No
GO:1901564 organonitrogen compound metabolic process No
GO:0044238 primary metabolic process No
GO:0008152 metabolic process No
GO:0003674 molecular_function No
GO:0004175 endopeptidase activity No
GO:0071704 organic substance metabolic process No
GO:0140096 catalytic activity, acting on a protein No
GO:0005488 binding No
GO:0016787 hydrolase activity No
GO:0019538 protein metabolic process No
GO:0006807 nitrogen compound metabolic process No
GO:0003824 catalytic activity No
GO:0070001 aspartic-type peptidase activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 22 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|6249
MTLSTLRESLHVESNVPPTSQHIYHNGRLISDDAKTMEQLQIADGDMLAVHVRETRGATAAPGQVQRTQEQPPAQ
PRRRQGGDNDPEMVRLQVLGNPALRQQLQSQQPELAAAVDDPVRFARLLHEAQDHERQDRLQRLREVERLNEDPF
NIENQRKIEDMIRQERVMENLQNAMEHNPEVFGRVHMLYVNVEVNGHKVKAFVDSGAQATIISPSCAEACGIMRL
VDTRFAGVARGVGTANIIGRVHSAQIKIGSLHLPCSFTVMEGKTTDLLLGLDMLKRYQATLDLAGDRLVIQGEEI
PFLGEADIPKEEEVIAQEPTIPGPAGTTIGQRSGVVMPPEQAPASQPAPTPPQPAPSHQPQATTAPSHGQPAAAA
GSNVTPAHVDNLMAMGATREQAIQALQAAEDNVDVAASLIFF
Coding >Ophio5|6249
ATGACCCTTTCTACGCTGCGCGAGTCCCTCCATGTCGAGAGCAACGTGCCTCCCACTTCCCAGCACATCTATCAC
AACGGGCGCCTGATATCCGATGACGCCAAAACCATGGAGCAGCTCCAGATTGCCGACGGAGATATGCTGGCCGTC
CACGTGAGGGAGACGCGAGGCGCCACGGCCGCGCCTGGCCAAGTACAGCGCACGCAGGAGCAGCCGCCCGCGCAG
CCACGCCGGCGGCAGGGAGGCGACAACGACCCTGAAATGGTCAGGCTCCAGGTGCTCGGCAATCCCGCCCTGAGG
CAGCAGCTTCAGAGCCAGCAGCCCGAGCTGGCAGCCGCAGTCGATGACCCTGTCCGCTTCGCGCGCCTGCTTCAC
GAGGCCCAGGACCACGAGCGGCAAGATCGGCTCCAGAGGCTGCGAGAAGTCGAAAGGCTCAACGAAGACCCCTTC
AACATCGAAAACCAAAGGAAAATCGAAGATATGATCCGCCAGGAACGAGTCATGGAAAACTTGCAAAACGCCATG
GAGCATAACCCTGAAGTCTTTGGAAGAGTTCACATGCTCTACGTCAACGTCGAGGTCAACGGCCACAAGGTCAAG
GCCTTTGTGGATTCTGGAGCCCAGGCCACTATCATCTCTCCGTCCTGCGCCGAGGCATGCGGGATCATGAGACTC
GTTGACACCCGGTTCGCCGGCGTTGCACGAGGTGTGGGTACTGCCAATATCATCGGCCGCGTTCATTCGGCTCAG
ATTAAGATCGGGAGCCTCCATTTGCCCTGCAGCTTCACCGTCATGGAGGGCAAAACGACGGATCTGCTGCTCGGC
TTGGACATGCTCAAACGCTATCAGGCTACGCTGGACCTGGCCGGCGACAGGCTCGTCATCCAGGGCGAGGAGATT
CCTTTCCTCGGCGAGGCCGACATACCCAAGGAGGAGGAGGTCATCGCGCAGGAACCCACGATACCGGGCCCGGCA
GGCACCACCATTGGCCAGCGGTCGGGCGTCGTCATGCCGCCGGAGCAGGCTCCAGCGTCACAGCCAGCTCCTACG
CCGCCCCAGCCGGCGCCTAGCCACCAGCCGCAGGCGACCACGGCTCCCTCCCACGGTCAGCCTGCTGCCGCTGCT
GGCTCAAACGTCACACCCGCTCACGTCGACAATCTCATGGCCATGGGCGCGACGAGGGAGCAGGCTATTCAGGCT
CTGCAGGCGGCCGAGGACAACGTCGACGTGGCCGCCAGCCTGATTTTCTTC
Transcript >Ophio5|6249
ATGACCCTTTCTACGCTGCGCGAGTCCCTCCATGTCGAGAGCAACGTGCCTCCCACTTCCCAGCACATCTATCAC
AACGGGCGCCTGATATCCGATGACGCCAAAACCATGGAGCAGCTCCAGATTGCCGACGGAGATATGCTGGCCGTC
CACGTGAGGGAGACGCGAGGCGCCACGGCCGCGCCTGGCCAAGTACAGCGCACGCAGGAGCAGCCGCCCGCGCAG
CCACGCCGGCGGCAGGGAGGCGACAACGACCCTGAAATGGTCAGGCTCCAGGTGCTCGGCAATCCCGCCCTGAGG
CAGCAGCTTCAGAGCCAGCAGCCCGAGCTGGCAGCCGCAGTCGATGACCCTGTCCGCTTCGCGCGCCTGCTTCAC
GAGGCCCAGGACCACGAGCGGCAAGATCGGCTCCAGAGGCTGCGAGAAGTCGAAAGGCTCAACGAAGACCCCTTC
AACATCGAAAACCAAAGGAAAATCGAAGATATGATCCGCCAGGAACGAGTCATGGAAAACTTGCAAAACGCCATG
GAGCATAACCCTGAAGTCTTTGGAAGAGTTCACATGCTCTACGTCAACGTCGAGGTCAACGGCCACAAGGTCAAG
GCCTTTGTGGATTCTGGAGCCCAGGCCACTATCATCTCTCCGTCCTGCGCCGAGGCATGCGGGATCATGAGACTC
GTTGACACCCGGTTCGCCGGCGTTGCACGAGGTGTGGGTACTGCCAATATCATCGGCCGCGTTCATTCGGCTCAG
ATTAAGATCGGGAGCCTCCATTTGCCCTGCAGCTTCACCGTCATGGAGGGCAAAACGACGGATCTGCTGCTCGGC
TTGGACATGCTCAAACGCTATCAGGCTACGCTGGACCTGGCCGGCGACAGGCTCGTCATCCAGGGCGAGGAGATT
CCTTTCCTCGGCGAGGCCGACATACCCAAGGAGGAGGAGGTCATCGCGCAGGAACCCACGATACCGGGCCCGGCA
GGCACCACCATTGGCCAGCGGTCGGGCGTCGTCATGCCGCCGGAGCAGGCTCCAGCGTCACAGCCAGCTCCTACG
CCGCCCCAGCCGGCGCCTAGCCACCAGCCGCAGGCGACCACGGCTCCCTCCCACGGTCAGCCTGCTGCCGCTGCT
GGCTCAAACGTCACACCCGCTCACGTCGACAATCTCATGGCCATGGGCGCGACGAGGGAGCAGGCTATTCAGGCT
CTGCAGGCGGCCGAGGACAACGTCGACGTGGCCGCCAGCCTGATTTTCTTCTAA
Gene >Ophio5|6249
ATGACCCTTTCTACGCTGCGCGAGTCCCTCCATGTCGAGAGCAACGTGCCTCCCACTTCCCAGCACATCTATCAC
AACGGGCGCCTGATATCCGATGACGCCAAAACCATGGAGCAGCTCCAGATTGCCGACGGAGATATGCTGGCCGTC
CACGTGAGGGAGACGCGAGGCGCCACGGCCGCGCCTGGCCAAGTACAGCGCACGCAGGAGCAGCCGCCCGCGCAG
CCACGCCGGCGGCAGGGAGGCGACAACGACCCTGAAATGGTCAGGCTCCAGGTGCTCGGCAATCCCGCCCTGAGG
CAGCAGCTTCAGAGCCAGCAGCCCGAGCTGGCAGCCGCAGTCGATGACCCTGTCCGCTTCGCGCGCCTGCTTCAC
GAGGCCCAGGACCACGAGCGGCAAGATCGGCTCCAGAGGCTGCGAGAAGTCGAAAGGCTCAACGAAGACCCCTTC
AACATCGAAAACCAAAGGAAAATCGAAGATATGATCCGCCAGGAACGAGTCATGGAAAACTTGCAAAACGCCATG
GAGCATAACCCTGAAGGTGGGCTCACCGTGGCTGCCCGTGCATTGCGTCAAGGCTAATCCGTCTCTGCTCAGTCT
TTGGAAGAGTTCACATGCTCTACGTCAACGTCGAGGTCAACGGCCACAAGGTCAAGGCCTTTGTGGATTCTGGAG
CCCAGGCCACTATCATCTCTCCGTCCTGCGCCGAGGCATGCGGGATCATGAGACTCGTTGACACCCGGTTCGCCG
GCGTTGCACGAGGTGTGGGTACTGCCAATATCATCGGCCGCGTTCATTCGGCTCAGATTAAGATCGGGAGCCTCC
ATTTGCCCTGCAGCTTCACCGTCATGGAGGGCAAAACGACGGATCTGCTGCTCGGCTTGGACATGCTCAAACGCT
ATCAGGCTACGCTGGACCTGGCCGGCGACAGGCTCGTCATCCAGGGCGAGGAGATTCCTTTCCTCGGCGAGGCCG
ACATACCCAAGGAGGAGGAGGTCATCGCGCAGGAACCCACGATACCGGGCCCGGCAGGCACCACCATTGGCCAGC
GGTCGGGCGTCGTCATGCCGCCGGAGCAGGCTCCAGCGTCACAGCCAGCTCCTACGCCGCCCCAGCCGGCGCCTA
GCCACCAGCCGCAGGCGACCACGGCTCCCTCCCACGGTCAGCCTGCTGCCGCTGCTGGCTCAAACGTCACACCCG
CTCACGTCGACAATCTCATGGCCATGGGCGCGACGAGGGAGCAGGCTATTCAGGCTCTGCAGGCGGCCGAGGACA
ACGTCGACGTGGCCGCCAGCCTGATTTTCTTCTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail