Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|6248
Gene name
Locationscaffold_539:1870..3970
Strand+
Gene length (bp)2100
Transcript length (bp)1920
Coding sequence length (bp)1917
Protein length (aa) 639

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF05148 Methyltransf_8 Hypothetical methyltransferase 3.6E-56 299 498

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P38961|RRP8_YEAST 25S rRNA (adenine(645)-N(1))-methyltransferase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RRP8 PE=1 SV=2 246 494 2.0E-55
sp|Q10257|RRP8_SCHPO 25S rRNA (adenine(645)-N(1))-methyltransferase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rrp8 PE=3 SV=1 251 493 3.0E-53
sp|Q54CP1|RRP8_DICDI Ribosomal RNA-processing protein 8 OS=Dictyostelium discoideum GN=rrp8 PE=3 SV=1 248 505 2.0E-43
sp|Q9DB85|RRP8_MOUSE Ribosomal RNA-processing protein 8 OS=Mus musculus GN=Rrp8 PE=1 SV=1 249 497 6.0E-43
sp|O43159|RRP8_HUMAN Ribosomal RNA-processing protein 8 OS=Homo sapiens GN=RRP8 PE=1 SV=2 250 497 2.0E-42
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P38961|RRP8_YEAST 25S rRNA (adenine(645)-N(1))-methyltransferase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RRP8 PE=1 SV=2 246 494 2.0E-55
sp|Q10257|RRP8_SCHPO 25S rRNA (adenine(645)-N(1))-methyltransferase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rrp8 PE=3 SV=1 251 493 3.0E-53
sp|Q54CP1|RRP8_DICDI Ribosomal RNA-processing protein 8 OS=Dictyostelium discoideum GN=rrp8 PE=3 SV=1 248 505 2.0E-43
sp|Q9DB85|RRP8_MOUSE Ribosomal RNA-processing protein 8 OS=Mus musculus GN=Rrp8 PE=1 SV=1 249 497 6.0E-43
sp|O43159|RRP8_HUMAN Ribosomal RNA-processing protein 8 OS=Homo sapiens GN=RRP8 PE=1 SV=2 250 497 2.0E-42
sp|Q5U4F0|RRP8_RAT Ribosomal RNA-processing protein 8 OS=Rattus norvegicus GN=Rrp8 PE=1 SV=1 249 497 1.0E-41
sp|Q84JC0|RRP8_ARATH Ribosomal RNA-processing protein 8 OS=Arabidopsis thaliana GN=At5g40530 PE=2 SV=1 278 502 5.0E-38
sp|O44410|RRP8_CAEEL Ribosomal RNA-processing protein 8 OS=Caenorhabditis elegans GN=T07A9.8 PE=3 SV=1 276 498 3.0E-34
sp|A8XI07|RRP8_CAEBR Ribosomal RNA-processing protein 8 OS=Caenorhabditis briggsae GN=CBG13492 PE=3 SV=1 293 512 1.0E-33
sp|Q7K2B0|RRP8_DROME Ribosomal RNA-processing protein 8 OS=Drosophila melanogaster GN=CG7137 PE=1 SV=1 285 497 7.0E-27
[Show less]

GO

GO Term Description Terminal node
GO:0008168 methyltransferase activity Yes
GO:0003824 catalytic activity No
GO:0016740 transferase activity No
GO:0003674 molecular_function No
GO:0016741 transferase activity, transferring one-carbon groups No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Nucleus Nuclear localization signal 0.2155 0.7691 0.2149 0.0102 0.1004 0.0109 0.0688 0.0065 0.1554 0.0051

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup1529
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|6113
Ophiocordyceps australis map64 (Brazil) OphauB2|3548
Ophiocordyceps camponoti-floridani Ophcf2|04169
Ophiocordyceps camponoti-rufipedis Ophun1|1229
Ophiocordyceps kimflemingae Ophio5|6248 (this protein)
Ophiocordyceps subramaniannii Hirsu2|1122

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|6248
MWHLHLLRRSHSGEKLPDASGHVRPARSDGSLPMERPLMVERVRSARQADRSVEWRHFERVCGEMQSLAIVRLVT
RSIHDRLQLQLLSTCAFSVLVRTGRENRCGTTASPRRLFAWQPENSSAPSVELQHDMFAVPGWSVPADSLKTEKA
PAGGGTDAARCKKRKRAGTSTSEPVTAANVVDLYEAVVEGKKRKDKKTLKRDQPSKRSETAPTTSKGSKAGKADV
KRDAKARHPRSEAEGDTKQKKDVGKQKQKEKPKRKSQDAAPHDDAESKAPAPESRSQAPALAPASAKTTKLTPLQ
ASMKEKLVSARFRHLNETLYTRPSDEAFRLFDESPEMFDDYHQGFRRQVKVWPENPVDSFLQDIRSRARAKTPSI
GRARPGNPPAKRSGDPLPRTAGTCTIADLGCGDARLAESLQAEKLKLRLKLLSYDLCSSSSLVTRADIAHLPLED
GSVNVAIFCLALMGTNWIDFIEEAYRILHWKGELWVAEIKSRFGPVRRAHNPVHHSVGNNRKRPAAAKAARGAEQ
DADDAQDLAVQVDGADDRSHRTDVSAFVEVLRHRGFVLRGEPNEAVDLSNRMFVKMHFVKAAAPTRGKGAKAQEA
AVKATKDAVAKRWLGDGQGDNAEDANEAAILKPCVYKTR
Coding >Ophio5|6248
ATGTGGCACCTGCATCTACTTAGACGGAGCCATTCCGGCGAGAAACTGCCTGATGCATCCGGCCATGTCCGCCCC
GCCCGCAGCGATGGATCTTTGCCTATGGAGAGGCCTTTGATGGTAGAACGCGTCCGTTCGGCGAGACAAGCAGAT
CGGTCCGTCGAGTGGCGGCATTTTGAAAGAGTGTGTGGGGAGATGCAATCCCTCGCAATTGTAAGGCTTGTGACA
CGAAGCATCCACGATCGTCTTCAGCTCCAACTTTTGAGCACTTGCGCATTTTCCGTTCTCGTACGGACAGGGAGG
GAAAACCGATGCGGGACGACAGCCTCACCACGACGTCTTTTCGCATGGCAGCCTGAAAACAGCTCAGCCCCTTCT
GTCGAGCTACAGCACGACATGTTTGCTGTACCAGGCTGGTCTGTGCCCGCCGACAGCCTCAAGACTGAGAAGGCC
CCGGCGGGCGGCGGGACCGACGCTGCCAGATGCAAGAAACGCAAGAGAGCCGGGACATCGACCTCTGAACCGGTC
ACGGCGGCCAACGTTGTCGACCTCTACGAGGCCGTTGTCGAGGGCAAGAAGAGGAAGGATAAAAAGACTTTGAAG
CGAGACCAACCATCCAAGCGGTCGGAGACAGCCCCAACAACATCCAAGGGGAGCAAGGCCGGCAAGGCCGATGTG
AAAAGGGACGCAAAAGCACGGCACCCCCGATCAGAAGCCGAGGGGGACACTAAACAAAAGAAGGACGTGGGCAAG
CAGAAGCAAAAGGAGAAGCCGAAGCGAAAGTCACAAGATGCCGCTCCTCATGACGACGCCGAGTCCAAGGCACCG
GCACCCGAATCCCGGTCCCAGGCTCCGGCCCTGGCTCCGGCGTCGGCCAAGACGACCAAACTGACGCCCCTGCAG
GCTTCGATGAAGGAAAAGCTGGTATCGGCCCGATTTCGCCATCTCAACGAGACGCTCTACACGCGGCCCTCGGAC
GAAGCTTTCCGGCTCTTTGACGAGTCTCCCGAAATGTTCGACGACTATCATCAAGGATTCAGACGGCAGGTCAAG
GTCTGGCCCGAGAACCCCGTCGACAGCTTTCTCCAAGACATCAGGTCGAGGGCCAGAGCTAAGACGCCCTCAATC
GGCAGGGCCAGGCCCGGCAATCCCCCGGCCAAGCGGTCGGGGGATCCGCTGCCGAGGACGGCCGGGACCTGCACC
ATTGCCGACCTCGGCTGTGGGGATGCCCGCCTCGCCGAGTCTCTTCAGGCGGAAAAGCTCAAGCTCCGGCTCAAA
CTACTGAGCTACGACCTTTGCAGCAGCTCTTCCCTGGTGACCAGAGCCGACATCGCTCACCTCCCCTTGGAAGAC
GGCTCCGTCAACGTAGCCATCTTCTGCCTCGCCCTCATGGGCACCAACTGGATCGACTTCATCGAGGAAGCCTAT
CGCATCCTCCACTGGAAAGGCGAGCTCTGGGTGGCTGAGATCAAGAGCCGCTTCGGCCCTGTCCGCCGCGCCCAC
AACCCCGTTCACCACAGCGTCGGCAACAACCGCAAGAGGCCTGCTGCCGCCAAGGCCGCACGCGGCGCCGAACAA
GACGCCGACGACGCCCAAGACCTGGCCGTTCAAGTCGACGGCGCCGACGACCGCAGCCACCGGACCGACGTGTCG
GCCTTCGTCGAGGTGCTCAGGCACAGAGGCTTTGTGCTCCGGGGGGAGCCCAACGAGGCCGTTGACTTGTCCAAC
CGCATGTTCGTCAAGATGCACTTTGTCAAGGCCGCTGCCCCTACGAGAGGCAAAGGCGCCAAGGCCCAGGAGGCG
GCCGTCAAGGCAACCAAAGATGCCGTCGCCAAGAGGTGGCTTGGGGACGGACAGGGTGACAATGCGGAGGACGCG
AATGAGGCAGCCATTCTCAAACCTTGTGTCTACAAGACTCGC
Transcript >Ophio5|6248
ATGTGGCACCTGCATCTACTTAGACGGAGCCATTCCGGCGAGAAACTGCCTGATGCATCCGGCCATGTCCGCCCC
GCCCGCAGCGATGGATCTTTGCCTATGGAGAGGCCTTTGATGGTAGAACGCGTCCGTTCGGCGAGACAAGCAGAT
CGGTCCGTCGAGTGGCGGCATTTTGAAAGAGTGTGTGGGGAGATGCAATCCCTCGCAATTGTAAGGCTTGTGACA
CGAAGCATCCACGATCGTCTTCAGCTCCAACTTTTGAGCACTTGCGCATTTTCCGTTCTCGTACGGACAGGGAGG
GAAAACCGATGCGGGACGACAGCCTCACCACGACGTCTTTTCGCATGGCAGCCTGAAAACAGCTCAGCCCCTTCT
GTCGAGCTACAGCACGACATGTTTGCTGTACCAGGCTGGTCTGTGCCCGCCGACAGCCTCAAGACTGAGAAGGCC
CCGGCGGGCGGCGGGACCGACGCTGCCAGATGCAAGAAACGCAAGAGAGCCGGGACATCGACCTCTGAACCGGTC
ACGGCGGCCAACGTTGTCGACCTCTACGAGGCCGTTGTCGAGGGCAAGAAGAGGAAGGATAAAAAGACTTTGAAG
CGAGACCAACCATCCAAGCGGTCGGAGACAGCCCCAACAACATCCAAGGGGAGCAAGGCCGGCAAGGCCGATGTG
AAAAGGGACGCAAAAGCACGGCACCCCCGATCAGAAGCCGAGGGGGACACTAAACAAAAGAAGGACGTGGGCAAG
CAGAAGCAAAAGGAGAAGCCGAAGCGAAAGTCACAAGATGCCGCTCCTCATGACGACGCCGAGTCCAAGGCACCG
GCACCCGAATCCCGGTCCCAGGCTCCGGCCCTGGCTCCGGCGTCGGCCAAGACGACCAAACTGACGCCCCTGCAG
GCTTCGATGAAGGAAAAGCTGGTATCGGCCCGATTTCGCCATCTCAACGAGACGCTCTACACGCGGCCCTCGGAC
GAAGCTTTCCGGCTCTTTGACGAGTCTCCCGAAATGTTCGACGACTATCATCAAGGATTCAGACGGCAGGTCAAG
GTCTGGCCCGAGAACCCCGTCGACAGCTTTCTCCAAGACATCAGGTCGAGGGCCAGAGCTAAGACGCCCTCAATC
GGCAGGGCCAGGCCCGGCAATCCCCCGGCCAAGCGGTCGGGGGATCCGCTGCCGAGGACGGCCGGGACCTGCACC
ATTGCCGACCTCGGCTGTGGGGATGCCCGCCTCGCCGAGTCTCTTCAGGCGGAAAAGCTCAAGCTCCGGCTCAAA
CTACTGAGCTACGACCTTTGCAGCAGCTCTTCCCTGGTGACCAGAGCCGACATCGCTCACCTCCCCTTGGAAGAC
GGCTCCGTCAACGTAGCCATCTTCTGCCTCGCCCTCATGGGCACCAACTGGATCGACTTCATCGAGGAAGCCTAT
CGCATCCTCCACTGGAAAGGCGAGCTCTGGGTGGCTGAGATCAAGAGCCGCTTCGGCCCTGTCCGCCGCGCCCAC
AACCCCGTTCACCACAGCGTCGGCAACAACCGCAAGAGGCCTGCTGCCGCCAAGGCCGCACGCGGCGCCGAACAA
GACGCCGACGACGCCCAAGACCTGGCCGTTCAAGTCGACGGCGCCGACGACCGCAGCCACCGGACCGACGTGTCG
GCCTTCGTCGAGGTGCTCAGGCACAGAGGCTTTGTGCTCCGGGGGGAGCCCAACGAGGCCGTTGACTTGTCCAAC
CGCATGTTCGTCAAGATGCACTTTGTCAAGGCCGCTGCCCCTACGAGAGGCAAAGGCGCCAAGGCCCAGGAGGCG
GCCGTCAAGGCAACCAAAGATGCCGTCGCCAAGAGGTGGCTTGGGGACGGACAGGGTGACAATGCGGAGGACGCG
AATGAGGCAGCCATTCTCAAACCTTGTGTCTACAAGACTCGCTGA
Gene >Ophio5|6248
ATGTGGCACCTGCATCTACTTAGACGGAGCCATTCCGGCGAGAAACTGCCTGATGCATCCGGCCATGTCCGCCCC
GCCCGCAGCGATGGATCTTTGCCTATGGAGAGGCCTTTGATGGTAGAACGCGTCCGTTCGGCGAGACAAGCAGAT
CGGTCCGTCGAGTGGCGGCATTTTGAAAGAGTGTGTGGGGAGATGCAATCCCTCGCAATTGTAAGGCTTGTGACA
CGAAGCATCCACGATCGTCTTCAGCTCCGTGAGTGGCTCCAACCCCGAACTCCTCTACCCTGGACAGACGTTGAC
GAGCTCGGGTGGAGTTACGGGTCTGAGTGCGGGAAGAACTTTTGAGCACTGTGTCCAGGTCACGTTTGAGAAAAA
AGCACTAGCATAATGCCCGCTTCGATTCGCGGAATAAAAAAATATTTGTTACTACGTAGATGATTTTCACAGTGC
GCATTTTCCGTTCTCGTACGGACAGGGAGGGAAAACCGATGCGGGACGACAGCCTCACCACGACGTCTTTTCGCA
TGGCAGCCTGAAAACAGCTCAGCCCCTTCTGTCGAGCTACAGCACGACATGTTTGCTGTACCAGGCTGGTCTGTG
CCCGCCGACAGCCTCAAGACTGAGAAGGCCCCGGCGGGCGGCGGGACCGACGCTGCCAGATGCAAGAAACGCAAG
AGAGCCGGGACATCGACCTCTGAACCGGTCACGGCGGCCAACGTTGTCGACCTCTACGAGGCCGTTGTCGAGGGC
AAGAAGAGGAAGGATAAAAAGACTTTGAAGCGAGACCAACCATCCAAGCGGTCGGAGACAGCCCCAACAACATCC
AAGGGGAGCAAGGCCGGCAAGGCCGATGTGAAAAGGGACGCAAAAGCACGGCACCCCCGATCAGAAGCCGAGGGG
GACACTAAACAAAAGAAGGACGTGGGCAAGCAGAAGCAAAAGGAGAAGCCGAAGCGAAAGTCACAAGATGCCGCT
CCTCATGACGACGCCGAGTCCAAGGCACCGGCACCCGAATCCCGGTCCCAGGCTCCGGCCCTGGCTCCGGCGTCG
GCCAAGACGACCAAACTGACGCCCCTGCAGGCTTCGATGAAGGAAAAGCTGGTATCGGCCCGATTTCGCCATCTC
AACGAGACGCTCTACACGCGGCCCTCGGACGAAGCTTTCCGGCTCTTTGACGAGTCTCCCGAAATGTTCGACGAC
TATCATCAAGGATTCAGACGGCAGGTCAAGGTCTGGCCCGAGAACCCCGTCGACAGCTTTCTCCAAGACATCAGG
TCGAGGGCCAGAGCTAAGACGCCCTCAATCGGCAGGGCCAGGCCCGGCAATCCCCCGGCCAAGCGGTCGGGGGAT
CCGCTGCCGAGGACGGCCGGGACCTGCACCATTGCCGACCTCGGCTGTGGGGATGCCCGCCTCGCCGAGTCTCTT
CAGGCGGAAAAGCTCAAGCTCCGGCTCAAACTACTGAGCTACGACCTTTGCAGCAGCTCTTCCCTGGTGACCAGA
GCCGACATCGCTCACCTCCCCTTGGAAGACGGCTCCGTCAACGTAGCCATCTTCTGCCTCGCCCTCATGGGCACC
AACTGGATCGACTTCATCGAGGAAGCCTATCGCATCCTCCACTGGAAAGGCGAGCTCTGGGTGGCTGAGATCAAG
AGCCGCTTCGGCCCTGTCCGCCGCGCCCACAACCCCGTTCACCACAGCGTCGGCAACAACCGCAAGAGGCCTGCT
GCCGCCAAGGCCGCACGCGGCGCCGAACAAGACGCCGACGACGCCCAAGACCTGGCCGTTCAAGTCGACGGCGCC
GACGACCGCAGCCACCGGACCGACGTGTCGGCCTTCGTCGAGGTGCTCAGGCACAGAGGCTTTGTGCTCCGGGGG
GAGCCCAACGAGGCCGTTGACTTGTCCAACCGCATGTTCGTCAAGATGCACTTTGTCAAGGCCGCTGCCCCTACG
AGAGGCAAAGGCGCCAAGGCCCAGGAGGCGGCCGTCAAGGCAACCAAAGATGCCGTCGCCAAGAGGTGGCTTGGG
GACGGACAGGGTGACAATGCGGAGGACGCGAATGAGGCAGCCATTCTCAAACCTTGTGTCTACAAGACTCGCTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail