Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|6223
Gene name
Locationscaffold_533:13014..14070
Strand-
Gene length (bp)1056
Transcript length (bp)1056
Coding sequence length (bp)1053
Protein length (aa) 351

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01223 Endonuclease_NS DNA/RNA non-specific endonuclease 1.6E-66 82 310

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P08466|NUC1_YEAST Mitochondrial nuclease OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=NUC1 PE=1 SV=1 57 331 6.0E-125
sp|Q10480|PNU1_SCHPO Nuclease 1, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pnu1 PE=2 SV=2 84 343 2.0E-100
sp|P81204|NUC1_SYNRA Nuclease OS=Syncephalastrum racemosum PE=1 SV=1 84 323 6.0E-73
sp|P81203|NUC1_CUNEE Nuclease C1 OS=Cunninghamella echinulata var. echinulata GN=NUC1CE PE=1 SV=1 84 325 2.0E-71
sp|Q95NM6|NUCG_CAEEL Endonuclease G, mitochondrial OS=Caenorhabditis elegans GN=cps-6 PE=1 SV=1 16 309 4.0E-59
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P08466|NUC1_YEAST Mitochondrial nuclease OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=NUC1 PE=1 SV=1 57 331 6.0E-125
sp|Q10480|PNU1_SCHPO Nuclease 1, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pnu1 PE=2 SV=2 84 343 2.0E-100
sp|P81204|NUC1_SYNRA Nuclease OS=Syncephalastrum racemosum PE=1 SV=1 84 323 6.0E-73
sp|P81203|NUC1_CUNEE Nuclease C1 OS=Cunninghamella echinulata var. echinulata GN=NUC1CE PE=1 SV=1 84 325 2.0E-71
sp|Q95NM6|NUCG_CAEEL Endonuclease G, mitochondrial OS=Caenorhabditis elegans GN=cps-6 PE=1 SV=1 16 309 4.0E-59
sp|O08600|NUCG_MOUSE Endonuclease G, mitochondrial OS=Mus musculus GN=Endog PE=1 SV=1 57 309 3.0E-57
sp|P38447|NUCG_BOVIN Endonuclease G, mitochondrial OS=Bos taurus GN=ENDOG PE=1 SV=1 84 309 4.0E-57
sp|Q14249|NUCG_HUMAN Endonuclease G, mitochondrial OS=Homo sapiens GN=ENDOG PE=1 SV=4 57 305 4.0E-57
sp|Q502K1|EXOG_DANRE Nuclease EXOG, mitochondrial OS=Danio rerio GN=exog PE=2 SV=2 87 326 3.0E-50
sp|Q8C163|EXOG_MOUSE Nuclease EXOG, mitochondrial OS=Mus musculus GN=Exog PE=1 SV=1 66 326 1.0E-45
sp|Q0IH72|EXOG_XENLA Nuclease EXOG, mitochondrial OS=Xenopus laevis GN=exog PE=2 SV=1 78 326 4.0E-45
sp|Q9Y2C4|EXOG_HUMAN Nuclease EXOG, mitochondrial OS=Homo sapiens GN=EXOG PE=1 SV=2 66 332 4.0E-45
sp|P38446|NUCA_NOSS1 Nuclease OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=nucA PE=1 SV=1 92 309 6.0E-15
sp|P13717|NUCA_SERMA Nuclease OS=Serratia marcescens GN=nucA PE=1 SV=2 99 310 2.0E-10
[Show less]

GO

GO Term Description Terminal node
GO:0016787 hydrolase activity Yes
GO:0046872 metal ion binding Yes
GO:0003676 nucleic acid binding Yes
GO:0097159 organic cyclic compound binding No
GO:0005488 binding No
GO:0003824 catalytic activity No
GO:0003674 molecular_function No
GO:0043169 cation binding No
GO:0043167 ion binding No
GO:1901363 heterocyclic compound binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 20 0.5

Transmembrane Domains

Domain # Start End Length
1 5 27 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
SC16a Pure fungal culture 72.51 39.44 105.59
CcL In ants, during behavior modification 132.64 70.48 194.80
CcD In ants, recently dead 127.47 69.15 185.79

Differential expression

Label1 Label2 Q-value Significant difference
SC16a CcL 0.004113 yes
SC16a CcD 0.008109 yes
CcL CcD 0.888594 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|6223
MSKSTLAMFAALGAGGGAALTAAVYSIRSSYASSESGGSSKVDSSVATSSRPSSAEIFGPSPTTVAAAAAAAAAT
RNPVDPAGLFEYGFPGPVSDLAFRSALVSSYDRRTRNPHWVVEHITPASLALREGDRQSSAFVEDDMVPAKFRAL
LRDYFRSGYDRGHQVPAADAKWSQTAMDDTFYLSNMCPQVGEGFNRDYWAHFEDFCRRLTVQYPSVRIVTGPLYL
PRKDPVDNKWYVRYEMIGSPPSVAVPTHFYKVIFAEDGKADGNVAIGAFVLPNARIANDKPITDFEVPVEAVERA
SGLEFATKLPVQRRRRLCADTACALVIRDYAERQKAFAKNDKRPVPSTPKS
Coding >Ophio5|6223
ATGTCCAAATCCACGCTCGCCATGTTTGCTGCTCTTGGTGCCGGGGGCGGAGCCGCCTTGACGGCCGCCGTTTAC
TCTATACGGTCGAGTTATGCGTCTTCGGAGAGTGGTGGTAGCAGCAAAGTTGATTCCTCGGTGGCTACGTCGTCA
CGACCTTCTTCGGCTGAGATTTTCGGTCCTTCCCCTACCACCGTGGCCGCCGCCGCCGCGGCAGCAGCAGCAACA
CGCAATCCCGTCGATCCAGCCGGCCTTTTCGAATATGGCTTTCCGGGACCGGTGTCGGATCTCGCGTTCCGGTCG
GCGCTGGTATCGAGTTACGATCGTCGAACGCGTAACCCGCACTGGGTTGTCGAGCATATCACGCCCGCGTCTCTG
GCTTTACGCGAGGGTGACCGGCAGTCTAGCGCGTTTGTGGAAGATGACATGGTGCCGGCCAAGTTTCGCGCTCTG
TTGCGTGACTACTTTCGCAGCGGATATGATCGCGGTCATCAGGTTCCGGCCGCGGATGCAAAGTGGTCGCAAACC
GCCATGGACGACACCTTTTATCTCTCCAACATGTGTCCCCAGGTCGGAGAGGGCTTCAACCGCGACTACTGGGCT
CACTTTGAAGACTTCTGTCGTCGCCTAACGGTCCAGTATCCTTCCGTCCGAATCGTTACCGGACCGCTTTACCTA
CCGCGCAAAGACCCCGTCGACAACAAGTGGTACGTCCGGTACGAAATGATAGGCAGTCCGCCCTCCGTCGCCGTC
CCGACGCATTTTTACAAGGTCATCTTCGCCGAGGATGGAAAGGCTGATGGCAATGTCGCCATCGGTGCCTTTGTT
CTTCCCAACGCTCGCATTGCCAATGATAAGCCCATTACCGACTTCGAGGTCCCTGTCGAGGCTGTCGAACGCGCA
AGTGGCCTCGAGTTCGCCACCAAGTTGCCCGTTCAGAGGAGGCGCAGACTCTGCGCTGATACCGCTTGCGCTCTC
GTCATTCGTGATTACGCTGAGAGGCAAAAGGCTTTTGCAAAGAATGACAAGCGGCCTGTCCCTTCCACGCCCAAG
TCT
Transcript >Ophio5|6223
ATGTCCAAATCCACGCTCGCCATGTTTGCTGCTCTTGGTGCCGGGGGCGGAGCCGCCTTGACGGCCGCCGTTTAC
TCTATACGGTCGAGTTATGCGTCTTCGGAGAGTGGTGGTAGCAGCAAAGTTGATTCCTCGGTGGCTACGTCGTCA
CGACCTTCTTCGGCTGAGATTTTCGGTCCTTCCCCTACCACCGTGGCCGCCGCCGCCGCGGCAGCAGCAGCAACA
CGCAATCCCGTCGATCCAGCCGGCCTTTTCGAATATGGCTTTCCGGGACCGGTGTCGGATCTCGCGTTCCGGTCG
GCGCTGGTATCGAGTTACGATCGTCGAACGCGTAACCCGCACTGGGTTGTCGAGCATATCACGCCCGCGTCTCTG
GCTTTACGCGAGGGTGACCGGCAGTCTAGCGCGTTTGTGGAAGATGACATGGTGCCGGCCAAGTTTCGCGCTCTG
TTGCGTGACTACTTTCGCAGCGGATATGATCGCGGTCATCAGGTTCCGGCCGCGGATGCAAAGTGGTCGCAAACC
GCCATGGACGACACCTTTTATCTCTCCAACATGTGTCCCCAGGTCGGAGAGGGCTTCAACCGCGACTACTGGGCT
CACTTTGAAGACTTCTGTCGTCGCCTAACGGTCCAGTATCCTTCCGTCCGAATCGTTACCGGACCGCTTTACCTA
CCGCGCAAAGACCCCGTCGACAACAAGTGGTACGTCCGGTACGAAATGATAGGCAGTCCGCCCTCCGTCGCCGTC
CCGACGCATTTTTACAAGGTCATCTTCGCCGAGGATGGAAAGGCTGATGGCAATGTCGCCATCGGTGCCTTTGTT
CTTCCCAACGCTCGCATTGCCAATGATAAGCCCATTACCGACTTCGAGGTCCCTGTCGAGGCTGTCGAACGCGCA
AGTGGCCTCGAGTTCGCCACCAAGTTGCCCGTTCAGAGGAGGCGCAGACTCTGCGCTGATACCGCTTGCGCTCTC
GTCATTCGTGATTACGCTGAGAGGCAAAAGGCTTTTGCAAAGAATGACAAGCGGCCTGTCCCTTCCACGCCCAAG
TCTTGA
Gene >Ophio5|6223
ATGTCCAAATCCACGCTCGCCATGTTTGCTGCTCTTGGTGCCGGGGGCGGAGCCGCCTTGACGGCCGCCGTTTAC
TCTATACGGTCGAGTTATGCGTCTTCGGAGAGTGGTGGTAGCAGCAAAGTTGATTCCTCGGTGGCTACGTCGTCA
CGACCTTCTTCGGCTGAGATTTTCGGTCCTTCCCCTACCACCGTGGCCGCCGCCGCCGCGGCAGCAGCAGCAACA
CGCAATCCCGTCGATCCAGCCGGCCTTTTCGAATATGGCTTTCCGGGACCGGTGTCGGATCTCGCGTTCCGGTCG
GCGCTGGTATCGAGTTACGATCGTCGAACGCGTAACCCGCACTGGGTTGTCGAGCATATCACGCCCGCGTCTCTG
GCTTTACGCGAGGGTGACCGGCAGTCTAGCGCGTTTGTGGAAGATGACATGGTGCCGGCCAAGTTTCGCGCTCTG
TTGCGTGACTACTTTCGCAGCGGATATGATCGCGGTCATCAGGTTCCGGCCGCGGATGCAAAGTGGTCGCAAACC
GCCATGGACGACACCTTTTATCTCTCCAACATGTGTCCCCAGGTCGGAGAGGGCTTCAACCGCGACTACTGGGCT
CACTTTGAAGACTTCTGTCGTCGCCTAACGGTCCAGTATCCTTCCGTCCGAATCGTTACCGGACCGCTTTACCTA
CCGCGCAAAGACCCCGTCGACAACAAGTGGTACGTCCGGTACGAAATGATAGGCAGTCCGCCCTCCGTCGCCGTC
CCGACGCATTTTTACAAGGTCATCTTCGCCGAGGATGGAAAGGCTGATGGCAATGTCGCCATCGGTGCCTTTGTT
CTTCCCAACGCTCGCATTGCCAATGATAAGCCCATTACCGACTTCGAGGTCCCTGTCGAGGCTGTCGAACGCGCA
AGTGGCCTCGAGTTCGCCACCAAGTTGCCCGTTCAGAGGAGGCGCAGACTCTGCGCTGATACCGCTTGCGCTCTC
GTCATTCGTGATTACGCTGAGAGGCAAAAGGCTTTTGCAAAGAATGACAAGCGGCCTGTCCCTTCCACGCCCAAG
TCTTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail