Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|6223
Gene name
Locationscaffold_533:13014..14070
Strand-
Gene length (bp)1056
Transcript length (bp)1056
Coding sequence length (bp)1053
Protein length (aa) 351

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01223 Endonuclease_NS DNA/RNA non-specific endonuclease 1.6E-66 82 310

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P08466|NUC1_YEAST Mitochondrial nuclease OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=NUC1 PE=1 SV=1 57 331 6.0E-125
sp|Q10480|PNU1_SCHPO Nuclease 1, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pnu1 PE=2 SV=2 84 343 2.0E-100
sp|P81204|NUC1_SYNRA Nuclease OS=Syncephalastrum racemosum PE=1 SV=1 84 323 6.0E-73
sp|P81203|NUC1_CUNEE Nuclease C1 OS=Cunninghamella echinulata var. echinulata GN=NUC1CE PE=1 SV=1 84 325 2.0E-71
sp|Q95NM6|NUCG_CAEEL Endonuclease G, mitochondrial OS=Caenorhabditis elegans GN=cps-6 PE=1 SV=1 16 309 4.0E-59
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P08466|NUC1_YEAST Mitochondrial nuclease OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=NUC1 PE=1 SV=1 57 331 6.0E-125
sp|Q10480|PNU1_SCHPO Nuclease 1, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pnu1 PE=2 SV=2 84 343 2.0E-100
sp|P81204|NUC1_SYNRA Nuclease OS=Syncephalastrum racemosum PE=1 SV=1 84 323 6.0E-73
sp|P81203|NUC1_CUNEE Nuclease C1 OS=Cunninghamella echinulata var. echinulata GN=NUC1CE PE=1 SV=1 84 325 2.0E-71
sp|Q95NM6|NUCG_CAEEL Endonuclease G, mitochondrial OS=Caenorhabditis elegans GN=cps-6 PE=1 SV=1 16 309 4.0E-59
sp|O08600|NUCG_MOUSE Endonuclease G, mitochondrial OS=Mus musculus GN=Endog PE=1 SV=1 57 309 3.0E-57
sp|P38447|NUCG_BOVIN Endonuclease G, mitochondrial OS=Bos taurus GN=ENDOG PE=1 SV=1 84 309 4.0E-57
sp|Q14249|NUCG_HUMAN Endonuclease G, mitochondrial OS=Homo sapiens GN=ENDOG PE=1 SV=4 57 305 4.0E-57
sp|Q502K1|EXOG_DANRE Nuclease EXOG, mitochondrial OS=Danio rerio GN=exog PE=2 SV=2 87 326 3.0E-50
sp|Q8C163|EXOG_MOUSE Nuclease EXOG, mitochondrial OS=Mus musculus GN=Exog PE=1 SV=1 66 326 1.0E-45
sp|Q0IH72|EXOG_XENLA Nuclease EXOG, mitochondrial OS=Xenopus laevis GN=exog PE=2 SV=1 78 326 4.0E-45
sp|Q9Y2C4|EXOG_HUMAN Nuclease EXOG, mitochondrial OS=Homo sapiens GN=EXOG PE=1 SV=2 66 332 4.0E-45
sp|P38446|NUCA_NOSS1 Nuclease OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=nucA PE=1 SV=1 92 309 6.0E-15
sp|P13717|NUCA_SERMA Nuclease OS=Serratia marcescens GN=nucA PE=1 SV=2 99 310 2.0E-10
[Show less]

GO

GO Term Description Terminal node
GO:0016787 hydrolase activity Yes
GO:0046872 metal ion binding Yes
GO:0003676 nucleic acid binding Yes
GO:0097159 organic cyclic compound binding No
GO:0005488 binding No
GO:0003824 catalytic activity No
GO:0003674 molecular_function No
GO:0043169 cation binding No
GO:0043167 ion binding No
GO:1901363 heterocyclic compound binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 20 0.5

Transmembrane Domains

Domain # Start End Length
1 5 27 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|6223
MSKSTLAMFAALGAGGGAALTAAVYSIRSSYASSESGGSSKVDSSVATSSRPSSAEIFGPSPTTVAAAAAAAAAT
RNPVDPAGLFEYGFPGPVSDLAFRSALVSSYDRRTRNPHWVVEHITPASLALREGDRQSSAFVEDDMVPAKFRAL
LRDYFRSGYDRGHQVPAADAKWSQTAMDDTFYLSNMCPQVGEGFNRDYWAHFEDFCRRLTVQYPSVRIVTGPLYL
PRKDPVDNKWYVRYEMIGSPPSVAVPTHFYKVIFAEDGKADGNVAIGAFVLPNARIANDKPITDFEVPVEAVERA
SGLEFATKLPVQRRRRLCADTACALVIRDYAERQKAFAKNDKRPVPSTPKS
Coding >Ophio5|6223
ATGTCCAAATCCACGCTCGCCATGTTTGCTGCTCTTGGTGCCGGGGGCGGAGCCGCCTTGACGGCCGCCGTTTAC
TCTATACGGTCGAGTTATGCGTCTTCGGAGAGTGGTGGTAGCAGCAAAGTTGATTCCTCGGTGGCTACGTCGTCA
CGACCTTCTTCGGCTGAGATTTTCGGTCCTTCCCCTACCACCGTGGCCGCCGCCGCCGCGGCAGCAGCAGCAACA
CGCAATCCCGTCGATCCAGCCGGCCTTTTCGAATATGGCTTTCCGGGACCGGTGTCGGATCTCGCGTTCCGGTCG
GCGCTGGTATCGAGTTACGATCGTCGAACGCGTAACCCGCACTGGGTTGTCGAGCATATCACGCCCGCGTCTCTG
GCTTTACGCGAGGGTGACCGGCAGTCTAGCGCGTTTGTGGAAGATGACATGGTGCCGGCCAAGTTTCGCGCTCTG
TTGCGTGACTACTTTCGCAGCGGATATGATCGCGGTCATCAGGTTCCGGCCGCGGATGCAAAGTGGTCGCAAACC
GCCATGGACGACACCTTTTATCTCTCCAACATGTGTCCCCAGGTCGGAGAGGGCTTCAACCGCGACTACTGGGCT
CACTTTGAAGACTTCTGTCGTCGCCTAACGGTCCAGTATCCTTCCGTCCGAATCGTTACCGGACCGCTTTACCTA
CCGCGCAAAGACCCCGTCGACAACAAGTGGTACGTCCGGTACGAAATGATAGGCAGTCCGCCCTCCGTCGCCGTC
CCGACGCATTTTTACAAGGTCATCTTCGCCGAGGATGGAAAGGCTGATGGCAATGTCGCCATCGGTGCCTTTGTT
CTTCCCAACGCTCGCATTGCCAATGATAAGCCCATTACCGACTTCGAGGTCCCTGTCGAGGCTGTCGAACGCGCA
AGTGGCCTCGAGTTCGCCACCAAGTTGCCCGTTCAGAGGAGGCGCAGACTCTGCGCTGATACCGCTTGCGCTCTC
GTCATTCGTGATTACGCTGAGAGGCAAAAGGCTTTTGCAAAGAATGACAAGCGGCCTGTCCCTTCCACGCCCAAG
TCT
Transcript >Ophio5|6223
ATGTCCAAATCCACGCTCGCCATGTTTGCTGCTCTTGGTGCCGGGGGCGGAGCCGCCTTGACGGCCGCCGTTTAC
TCTATACGGTCGAGTTATGCGTCTTCGGAGAGTGGTGGTAGCAGCAAAGTTGATTCCTCGGTGGCTACGTCGTCA
CGACCTTCTTCGGCTGAGATTTTCGGTCCTTCCCCTACCACCGTGGCCGCCGCCGCCGCGGCAGCAGCAGCAACA
CGCAATCCCGTCGATCCAGCCGGCCTTTTCGAATATGGCTTTCCGGGACCGGTGTCGGATCTCGCGTTCCGGTCG
GCGCTGGTATCGAGTTACGATCGTCGAACGCGTAACCCGCACTGGGTTGTCGAGCATATCACGCCCGCGTCTCTG
GCTTTACGCGAGGGTGACCGGCAGTCTAGCGCGTTTGTGGAAGATGACATGGTGCCGGCCAAGTTTCGCGCTCTG
TTGCGTGACTACTTTCGCAGCGGATATGATCGCGGTCATCAGGTTCCGGCCGCGGATGCAAAGTGGTCGCAAACC
GCCATGGACGACACCTTTTATCTCTCCAACATGTGTCCCCAGGTCGGAGAGGGCTTCAACCGCGACTACTGGGCT
CACTTTGAAGACTTCTGTCGTCGCCTAACGGTCCAGTATCCTTCCGTCCGAATCGTTACCGGACCGCTTTACCTA
CCGCGCAAAGACCCCGTCGACAACAAGTGGTACGTCCGGTACGAAATGATAGGCAGTCCGCCCTCCGTCGCCGTC
CCGACGCATTTTTACAAGGTCATCTTCGCCGAGGATGGAAAGGCTGATGGCAATGTCGCCATCGGTGCCTTTGTT
CTTCCCAACGCTCGCATTGCCAATGATAAGCCCATTACCGACTTCGAGGTCCCTGTCGAGGCTGTCGAACGCGCA
AGTGGCCTCGAGTTCGCCACCAAGTTGCCCGTTCAGAGGAGGCGCAGACTCTGCGCTGATACCGCTTGCGCTCTC
GTCATTCGTGATTACGCTGAGAGGCAAAAGGCTTTTGCAAAGAATGACAAGCGGCCTGTCCCTTCCACGCCCAAG
TCTTGA
Gene >Ophio5|6223
ATGTCCAAATCCACGCTCGCCATGTTTGCTGCTCTTGGTGCCGGGGGCGGAGCCGCCTTGACGGCCGCCGTTTAC
TCTATACGGTCGAGTTATGCGTCTTCGGAGAGTGGTGGTAGCAGCAAAGTTGATTCCTCGGTGGCTACGTCGTCA
CGACCTTCTTCGGCTGAGATTTTCGGTCCTTCCCCTACCACCGTGGCCGCCGCCGCCGCGGCAGCAGCAGCAACA
CGCAATCCCGTCGATCCAGCCGGCCTTTTCGAATATGGCTTTCCGGGACCGGTGTCGGATCTCGCGTTCCGGTCG
GCGCTGGTATCGAGTTACGATCGTCGAACGCGTAACCCGCACTGGGTTGTCGAGCATATCACGCCCGCGTCTCTG
GCTTTACGCGAGGGTGACCGGCAGTCTAGCGCGTTTGTGGAAGATGACATGGTGCCGGCCAAGTTTCGCGCTCTG
TTGCGTGACTACTTTCGCAGCGGATATGATCGCGGTCATCAGGTTCCGGCCGCGGATGCAAAGTGGTCGCAAACC
GCCATGGACGACACCTTTTATCTCTCCAACATGTGTCCCCAGGTCGGAGAGGGCTTCAACCGCGACTACTGGGCT
CACTTTGAAGACTTCTGTCGTCGCCTAACGGTCCAGTATCCTTCCGTCCGAATCGTTACCGGACCGCTTTACCTA
CCGCGCAAAGACCCCGTCGACAACAAGTGGTACGTCCGGTACGAAATGATAGGCAGTCCGCCCTCCGTCGCCGTC
CCGACGCATTTTTACAAGGTCATCTTCGCCGAGGATGGAAAGGCTGATGGCAATGTCGCCATCGGTGCCTTTGTT
CTTCCCAACGCTCGCATTGCCAATGATAAGCCCATTACCGACTTCGAGGTCCCTGTCGAGGCTGTCGAACGCGCA
AGTGGCCTCGAGTTCGCCACCAAGTTGCCCGTTCAGAGGAGGCGCAGACTCTGCGCTGATACCGCTTGCGCTCTC
GTCATTCGTGATTACGCTGAGAGGCAAAAGGCTTTTGCAAAGAATGACAAGCGGCCTGTCCCTTCCACGCCCAAG
TCTTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail