Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|622
Gene name
Locationscaffold_1164:1127..2252
Strand+
Gene length (bp)1125
Transcript length (bp)984
Coding sequence length (bp)981
Protein length (aa) 327

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01490 Aa_trans Transmembrane amino acid transporter protein 2.7E-22 2 140
PF01490 Aa_trans Transmembrane amino acid transporter protein 1.9E-33 143 321

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P36062|AVT3_YEAST Vacuolar amino acid transporter 3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=AVT3 PE=1 SV=1 1 324 4.0E-77
sp|Q10074|AVT3_SCHPO Vacuolar amino acid transporter 3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=avt3 PE=1 SV=1 1 321 4.0E-68
sp|P50944|AVT4_YEAST Vacuolar amino acid transporter 4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=AVT4 PE=1 SV=1 1 317 1.0E-54
sp|Q9SF09|ANT1_ARATH Amino acid transporter ANT1 OS=Arabidopsis thaliana GN=ANT1 PE=1 SV=1 3 322 7.0E-14
sp|Q4KL91|S36A4_XENLA Proton-coupled amino acid transporter 4 OS=Xenopus laevis GN=slc36a4 PE=2 SV=1 3 325 3.0E-13
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P36062|AVT3_YEAST Vacuolar amino acid transporter 3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=AVT3 PE=1 SV=1 1 324 4.0E-77
sp|Q10074|AVT3_SCHPO Vacuolar amino acid transporter 3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=avt3 PE=1 SV=1 1 321 4.0E-68
sp|P50944|AVT4_YEAST Vacuolar amino acid transporter 4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=AVT4 PE=1 SV=1 1 317 1.0E-54
sp|Q9SF09|ANT1_ARATH Amino acid transporter ANT1 OS=Arabidopsis thaliana GN=ANT1 PE=1 SV=1 3 322 7.0E-14
sp|Q4KL91|S36A4_XENLA Proton-coupled amino acid transporter 4 OS=Xenopus laevis GN=slc36a4 PE=2 SV=1 3 325 3.0E-13
sp|Q8K415|S36A2_RAT Proton-coupled amino acid transporter 2 OS=Rattus norvegicus GN=Slc36a2 PE=1 SV=1 3 221 4.0E-10
sp|Q8CH36|S36A4_MOUSE Proton-coupled amino acid transporter 4 OS=Mus musculus GN=Slc36a4 PE=2 SV=1 3 319 2.0E-09
sp|Q8BHK3|S36A2_MOUSE Proton-coupled amino acid transporter 2 OS=Mus musculus GN=Slc36a2 PE=1 SV=1 3 221 3.0E-09
sp|Q9FKY3|ANTL3_ARATH Amino acid transporter ANTL3 OS=Arabidopsis thaliana GN=At5g65990 PE=2 SV=1 3 288 5.0E-09
sp|Q7Z2H8|S36A1_HUMAN Proton-coupled amino acid transporter 1 OS=Homo sapiens GN=SLC36A1 PE=1 SV=1 3 326 9.0E-09
sp|Q495N2|S36A3_HUMAN Proton-coupled amino acid transporter 3 OS=Homo sapiens GN=SLC36A3 PE=2 SV=2 3 323 2.0E-08
sp|Q8K4D3|S36A1_MOUSE Proton-coupled amino acid transporter 1 OS=Mus musculus GN=Slc36a1 PE=2 SV=1 66 326 3.0E-08
sp|Q6YBV0|S36A4_HUMAN Proton-coupled amino acid transporter 4 OS=Homo sapiens GN=SLC36A4 PE=1 SV=1 3 319 4.0E-08
sp|Q924A5|S36A1_RAT Proton-coupled amino acid transporter 1 OS=Rattus norvegicus GN=Slc36a1 PE=2 SV=1 64 323 2.0E-07
sp|Q9SVG0|ANTL2_ARATH Amino acid transporter ANTL2 OS=Arabidopsis thaliana GN=At4g38250 PE=1 SV=1 3 323 2.0E-07
sp|Q4V8B1|S36A3_RAT Proton-coupled amino acid transporter 3 OS=Rattus norvegicus GN=Slc36a3 PE=2 SV=1 3 323 2.0E-06
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.5

Transmembrane Domains

Domain # Start End Length
1 10 32 22
2 59 81 22
3 96 118 22
4 125 142 17
5 152 174 22
6 243 262 19
7 268 290 22
8 303 325 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|622
MFLPKAFLNGGILFSSLTLVVVSLINCLCFRLLLDCRQKHGGGYGELGAAIVGPRFRNTILASIALSQLGFVCAG
LIFTAENFLAFLQAISREREGFDIGVPGLIALQLIPLIPLALIRNISKLGHVALLADIFILIGLCASSMQKPENF
SALLYLVMFLITIIFTSVGALCYATFGEETKIQVISNFPQDSPVVNAVQLLYSLAVLGGEPVQLFPAVRIIETSL
FGERATGKRSMAIKWKKNAIRSAVMALCIAISMVGATDLDKFVALIGSFACVPLVYIYPAYLHYRGVAIKSWAKG
LDLVLMLLGIIAMVYTTIVTLVQWIDV
Coding >Ophio5|622
ATGTTTCTTCCCAAGGCCTTCCTCAACGGCGGCATATTGTTTTCTTCCTTGACCTTGGTTGTCGTATCGCTAATC
AACTGCTTGTGCTTCAGACTGCTACTTGACTGCCGTCAAAAGCACGGAGGGGGTTATGGAGAGTTGGGTGCCGCT
ATAGTCGGTCCGCGGTTTCGCAACACTATCCTGGCATCCATCGCACTCTCACAATTGGGTTTTGTCTGTGCCGGC
CTCATTTTTACGGCGGAAAACTTCTTGGCTTTTCTGCAAGCAATATCCCGAGAACGTGAAGGATTTGATATTGGG
GTGCCTGGCCTTATCGCCCTTCAGCTCATACCTCTTATTCCCTTAGCTCTCATCCGAAACATATCCAAACTCGGC
CATGTGGCCTTGCTCGCCGACATCTTCATCCTTATCGGCTTGTGTGCGTCCAGCATGCAGAAGCCGGAGAACTTC
AGTGCCCTGTTATATCTTGTCATGTTTCTCATTACCATCATCTTCACGTCTGTCGGCGCGCTTTGCTACGCTACA
TTTGGTGAGGAAACGAAAATCCAGGTCATCTCCAACTTTCCGCAGGACTCCCCTGTCGTCAATGCCGTACAGCTA
TTGTATTCCCTGGCGGTGCTTGGGGGTGAACCTGTACAGCTTTTCCCCGCGGTACGCATCATCGAAACATCTCTG
TTCGGCGAACGAGCCACGGGCAAGAGGAGCATGGCCATCAAGTGGAAGAAAAATGCTATTCGATCAGCGGTGATG
GCGCTGTGCATCGCCATCAGCATGGTTGGGGCGACAGACCTGGATAAGTTTGTGGCCTTGATCGGAAGCTTCGCG
TGCGTTCCGCTTGTATACATTTACCCGGCGTATTTGCACTACAGAGGCGTTGCGATTAAGAGCTGGGCTAAGGGG
CTAGATCTCGTCCTGATGCTCTTAGGCATCATTGCCATGGTCTACACAACCATCGTAACGTTGGTTCAGTGGATT
GACGTG
Transcript >Ophio5|622
ATGTTTCTTCCCAAGGCCTTCCTCAACGGCGGCATATTGTTTTCTTCCTTGACCTTGGTTGTCGTATCGCTAATC
AACTGCTTGTGCTTCAGACTGCTACTTGACTGCCGTCAAAAGCACGGAGGGGGTTATGGAGAGTTGGGTGCCGCT
ATAGTCGGTCCGCGGTTTCGCAACACTATCCTGGCATCCATCGCACTCTCACAATTGGGTTTTGTCTGTGCCGGC
CTCATTTTTACGGCGGAAAACTTCTTGGCTTTTCTGCAAGCAATATCCCGAGAACGTGAAGGATTTGATATTGGG
GTGCCTGGCCTTATCGCCCTTCAGCTCATACCTCTTATTCCCTTAGCTCTCATCCGAAACATATCCAAACTCGGC
CATGTGGCCTTGCTCGCCGACATCTTCATCCTTATCGGCTTGTGTGCGTCCAGCATGCAGAAGCCGGAGAACTTC
AGTGCCCTGTTATATCTTGTCATGTTTCTCATTACCATCATCTTCACGTCTGTCGGCGCGCTTTGCTACGCTACA
TTTGGTGAGGAAACGAAAATCCAGGTCATCTCCAACTTTCCGCAGGACTCCCCTGTCGTCAATGCCGTACAGCTA
TTGTATTCCCTGGCGGTGCTTGGGGGTGAACCTGTACAGCTTTTCCCCGCGGTACGCATCATCGAAACATCTCTG
TTCGGCGAACGAGCCACGGGCAAGAGGAGCATGGCCATCAAGTGGAAGAAAAATGCTATTCGATCAGCGGTGATG
GCGCTGTGCATCGCCATCAGCATGGTTGGGGCGACAGACCTGGATAAGTTTGTGGCCTTGATCGGAAGCTTCGCG
TGCGTTCCGCTTGTATACATTTACCCGGCGTATTTGCACTACAGAGGCGTTGCGATTAAGAGCTGGGCTAAGGGG
CTAGATCTCGTCCTGATGCTCTTAGGCATCATTGCCATGGTCTACACAACCATCGTAACGTTGGTTCAGTGGATT
GACGTGTAG
Gene >Ophio5|622
ATGTTTCTTCCCAAGGCCTTCCTCAACGGCGGCATATTGTTTTCTTCCTTGACCTTGGTTGTCGTATCGCTAATC
AACTGCTTGTGCTTCAGACTGCTACTTGACTGCCGTCAAAAGCACGGAGGGGGTTATGGAGAGTTGGGTGCCGCT
ATAGTCGGTCCGCGGTTTCGCAACACTATCCTGGCATCCATCGCACTCTCACAATTGGGTTTTGTCTGTGCCGGC
CTCATTTTTACGGCGGAAAACTTCTTGGCTTTTCTGCAAGCAATATCCCGAGAACGTGAAGGATTTGATATTGGG
GTGCCTGGCCTTATCGCCCTTCAGCTCATACCTCTTATTCCCTTAGCTCTCATCCGAAACATATCCAAACTCGGC
CATGTGGCCTTGCTCGCCGACATCTTCATCCTTATCGGCTTGGTCTACATCTGGTACTTCGATCTCTGGACGCTC
GCACAGTCTGGAGTCGATCCCAGTGTGCGGTTGTTCAATCCTTCCACTTTCACACTAACCATCGGATCGGCTATC
TTTACCTTTGAGGGGATTGGACTAATCTTGCCCATACAGTCCAGCATGCAGAAGCCGGAGAACTTCAGTGCCCTG
TTATATCTTGTCATGTTTCTCATTACCATCATCTTCACGTCTGTCGGCGCGCTTTGCTACGCTACATTTGGTGAG
GAAACGAAAATCCAGGTCATCTCCAACTTTCCGCAGGACTCCCCTGTCGTCAATGCCGTACAGCTATTGTATTCC
CTGGCGGTGCTTGGGGGTGAACCTGTACAGCTTTTCCCCGCGGTACGCATCATCGAAACATCTCTGTTCGGCGAA
CGAGCCACGGGCAAGAGGAGCATGGCCATCAAGTGGAAGAAAAATGCTATTCGATCAGCGGTGATGGCGCTGTGC
ATCGCCATCAGCATGGTTGGGGCGACAGACCTGGATAAGTTTGTGGCCTTGATCGGAAGCTTCGCGTGCGTTCCG
CTTGTATACATTTACCCGGCGTATTTGCACTACAGAGGCGTTGCGATTAAGAGCTGGGCTAAGGGGCTAGATCTC
GTCCTGATGCTCTTAGGCATCATTGCCATGGTCTACACAACCATCGTAACGTTGGTTCAGTGGATTGACGTGTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail