Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|6210
Gene name
Locationscaffold_531:8112..9675
Strand+
Gene length (bp)1563
Transcript length (bp)1563
Coding sequence length (bp)1560
Protein length (aa) 520

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00150 Cellulase Cellulase (glycosyl hydrolase family 5) 3.2E-35 207 484

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P23548|GUN_PAEPO Endoglucanase OS=Paenibacillus polymyxa PE=3 SV=2 158 503 4.0E-41
sp|P54583|GUN1_ACIC1 Endoglucanase E1 OS=Acidothermus cellulolyticus (strain ATCC 43068 / 11B) GN=Acel_0614 PE=1 SV=1 170 503 4.0E-36
sp|P10474|GUNB_CALSA Endoglucanase/exoglucanase B OS=Caldicellulosiruptor saccharolyticus GN=celB PE=3 SV=1 168 503 3.0E-24
sp|P50400|GUND_CELFI Endoglucanase D OS=Cellulomonas fimi GN=cenD PE=3 SV=1 168 503 4.0E-24
sp|P19487|GUNA_XANCP Major extracellular endoglucanase OS=Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25) GN=engXCA PE=1 SV=2 173 503 3.0E-22
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P23548|GUN_PAEPO Endoglucanase OS=Paenibacillus polymyxa PE=3 SV=2 158 503 4.0E-41
sp|P54583|GUN1_ACIC1 Endoglucanase E1 OS=Acidothermus cellulolyticus (strain ATCC 43068 / 11B) GN=Acel_0614 PE=1 SV=1 170 503 4.0E-36
sp|P10474|GUNB_CALSA Endoglucanase/exoglucanase B OS=Caldicellulosiruptor saccharolyticus GN=celB PE=3 SV=1 168 503 3.0E-24
sp|P50400|GUND_CELFI Endoglucanase D OS=Cellulomonas fimi GN=cenD PE=3 SV=1 168 503 4.0E-24
sp|P19487|GUNA_XANCP Major extracellular endoglucanase OS=Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25) GN=engXCA PE=1 SV=2 173 503 3.0E-22
sp|P04956|GUNB_CLOTH Endoglucanase B OS=Clostridium thermocellum (strain ATCC 27405 / DSM 1237 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) GN=celB PE=3 SV=1 168 453 1.0E-14
[Show less]

GO

GO Term Description Terminal node
GO:0004553 hydrolase activity, hydrolyzing O-glycosyl compounds Yes
GO:0071704 organic substance metabolic process Yes
GO:0016787 hydrolase activity No
GO:0003824 catalytic activity No
GO:0008150 biological_process No
GO:0003674 molecular_function No
GO:0008152 metabolic process No
GO:0016798 hydrolase activity, acting on glycosyl bonds No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 68 0.45

Transmembrane Domains

Domain # Start End Length
1 111 128 17

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
SC16a Pure fungal culture 12.97 5.47 20.46
CcL In ants, during behavior modification 8.66 2.95 14.36
CcD In ants, recently dead 4.96 1.41 8.51

Differential expression

Label1 Label2 Q-value Significant difference
SC16a CcL 0.184258 no
SC16a CcD 0.002627 yes
CcL CcD 0.106796 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|6210
MAGGGDPPTGLASHSPPESPPLESPLESPLKSPLESFLAFSPSVPVTPLESLHSYGARPARQAAPPLKIINYDTW
VKVKGYPQLPLFRRPGSKRLRTVQKLRRWQPSPCKMFLILLAVVLVVLAGYIWRKEARLAARWEPDTESRLFSEK
PLPPPQQSSNISSYRLPLKTRGRDIVDEDGRRFKLSSVNWYGASDELFVVGGLEVQHRDVIAQTMLRLGFNSVRL
PYSDELVATNPVVDARQLSANPDLIGKRALDVLEVVVKSLTDAGLAVIVNNHITTATWCCGIDPCDSGWANDHLG
MLCRVGQTEEQWMRHWETVMARFVDNPRVIGADLRNEVRGLWGTMPWSRWAAAAERCGNRLLRLRSDWLIVVEGT
ESANDLSGARDRPIRLDVADRLVYSAHVYAWSGWGSLEGRFAQRDYDSFVKTMRHNWAYLLDQDIAPVWVGELGA
PHEPSNGDAHYWKNLWRYLKAVDADFGYWAINPRKPKDNEVETYSIVADDWVTPVLDYRLKDMIELMHAS
Coding >Ophio5|6210
ATGGCTGGCGGCGGGGATCCCCCAACGGGCCTGGCTTCCCATTCCCCGCCGGAGAGTCCTCCCCTGGAAAGTCCC
CTGGAAAGTCCCCTGAAAAGTCCCCTGGAAAGCTTCCTGGCCTTCAGCCCGAGCGTGCCGGTCACTCCGCTGGAA
AGCCTCCACTCTTACGGTGCTCGTCCCGCTCGGCAGGCGGCGCCGCCCCTGAAGATCATCAACTACGACACCTGG
GTCAAGGTCAAAGGCTACCCTCAGCTGCCGCTATTCCGGCGGCCCGGCTCGAAGAGGCTACGGACGGTCCAGAAG
CTTCGGCGGTGGCAGCCTTCGCCCTGTAAAATGTTTCTCATCTTGCTGGCCGTGGTGCTGGTGGTGTTGGCCGGC
TATATCTGGCGCAAGGAGGCTCGTCTGGCGGCCCGCTGGGAGCCGGACACGGAGTCGCGGCTTTTCAGCGAGAAG
CCTCTCCCGCCGCCTCAGCAGAGCAGCAACATCAGCTCGTACCGGCTCCCGCTGAAGACGCGAGGGCGCGACATC
GTCGACGAGGATGGACGACGCTTCAAGCTCTCGTCGGTCAACTGGTATGGCGCCAGCGACGAGCTCTTCGTGGTG
GGAGGGCTGGAAGTACAACATCGCGACGTGATTGCTCAGACGATGCTGCGCCTGGGCTTCAACAGCGTCCGGCTT
CCGTACTCGGATGAGCTGGTGGCGACGAATCCGGTCGTGGACGCGCGGCAGCTCAGTGCGAACCCGGACCTGATC
GGGAAGCGAGCGCTCGACGTGCTCGAGGTCGTCGTCAAGTCGCTGACGGACGCCGGCTTGGCCGTCATCGTCAAT
AACCACATCACCACGGCCACCTGGTGCTGCGGCATCGATCCCTGCGACTCTGGTTGGGCCAACGACCACCTCGGC
ATGCTGTGCCGGGTCGGCCAGACCGAGGAGCAGTGGATGCGCCATTGGGAGACGGTCATGGCTCGCTTCGTCGAC
AACCCGCGCGTCATCGGCGCCGACCTGCGCAACGAGGTCCGCGGACTATGGGGGACCATGCCCTGGTCTCGCTGG
GCGGCCGCGGCCGAGCGTTGCGGCAACCGGCTGCTCCGGCTTCGATCGGACTGGCTCATCGTCGTCGAAGGAACC
GAGTCGGCCAACGACCTATCGGGCGCGAGGGACCGGCCCATCCGTCTCGACGTCGCCGACCGTCTCGTCTACTCG
GCACACGTCTATGCCTGGTCCGGCTGGGGCAGCCTCGAGGGCCGGTTCGCGCAGCGGGACTACGACTCTTTCGTC
AAGACGATGCGCCACAACTGGGCCTATCTGCTGGATCAGGACATTGCCCCCGTCTGGGTCGGCGAGCTGGGCGCG
CCGCACGAGCCGTCCAACGGTGATGCCCACTACTGGAAAAACCTCTGGCGTTATCTCAAGGCCGTCGACGCCGAC
TTTGGATACTGGGCCATCAACCCGCGGAAGCCTAAGGACAACGAGGTTGAGACGTACTCGATTGTCGCCGATGAC
TGGGTCACGCCGGTGCTGGATTACCGCCTCAAGGACATGATTGAGCTTATGCACGCCTCT
Transcript >Ophio5|6210
ATGGCTGGCGGCGGGGATCCCCCAACGGGCCTGGCTTCCCATTCCCCGCCGGAGAGTCCTCCCCTGGAAAGTCCC
CTGGAAAGTCCCCTGAAAAGTCCCCTGGAAAGCTTCCTGGCCTTCAGCCCGAGCGTGCCGGTCACTCCGCTGGAA
AGCCTCCACTCTTACGGTGCTCGTCCCGCTCGGCAGGCGGCGCCGCCCCTGAAGATCATCAACTACGACACCTGG
GTCAAGGTCAAAGGCTACCCTCAGCTGCCGCTATTCCGGCGGCCCGGCTCGAAGAGGCTACGGACGGTCCAGAAG
CTTCGGCGGTGGCAGCCTTCGCCCTGTAAAATGTTTCTCATCTTGCTGGCCGTGGTGCTGGTGGTGTTGGCCGGC
TATATCTGGCGCAAGGAGGCTCGTCTGGCGGCCCGCTGGGAGCCGGACACGGAGTCGCGGCTTTTCAGCGAGAAG
CCTCTCCCGCCGCCTCAGCAGAGCAGCAACATCAGCTCGTACCGGCTCCCGCTGAAGACGCGAGGGCGCGACATC
GTCGACGAGGATGGACGACGCTTCAAGCTCTCGTCGGTCAACTGGTATGGCGCCAGCGACGAGCTCTTCGTGGTG
GGAGGGCTGGAAGTACAACATCGCGACGTGATTGCTCAGACGATGCTGCGCCTGGGCTTCAACAGCGTCCGGCTT
CCGTACTCGGATGAGCTGGTGGCGACGAATCCGGTCGTGGACGCGCGGCAGCTCAGTGCGAACCCGGACCTGATC
GGGAAGCGAGCGCTCGACGTGCTCGAGGTCGTCGTCAAGTCGCTGACGGACGCCGGCTTGGCCGTCATCGTCAAT
AACCACATCACCACGGCCACCTGGTGCTGCGGCATCGATCCCTGCGACTCTGGTTGGGCCAACGACCACCTCGGC
ATGCTGTGCCGGGTCGGCCAGACCGAGGAGCAGTGGATGCGCCATTGGGAGACGGTCATGGCTCGCTTCGTCGAC
AACCCGCGCGTCATCGGCGCCGACCTGCGCAACGAGGTCCGCGGACTATGGGGGACCATGCCCTGGTCTCGCTGG
GCGGCCGCGGCCGAGCGTTGCGGCAACCGGCTGCTCCGGCTTCGATCGGACTGGCTCATCGTCGTCGAAGGAACC
GAGTCGGCCAACGACCTATCGGGCGCGAGGGACCGGCCCATCCGTCTCGACGTCGCCGACCGTCTCGTCTACTCG
GCACACGTCTATGCCTGGTCCGGCTGGGGCAGCCTCGAGGGCCGGTTCGCGCAGCGGGACTACGACTCTTTCGTC
AAGACGATGCGCCACAACTGGGCCTATCTGCTGGATCAGGACATTGCCCCCGTCTGGGTCGGCGAGCTGGGCGCG
CCGCACGAGCCGTCCAACGGTGATGCCCACTACTGGAAAAACCTCTGGCGTTATCTCAAGGCCGTCGACGCCGAC
TTTGGATACTGGGCCATCAACCCGCGGAAGCCTAAGGACAACGAGGTTGAGACGTACTCGATTGTCGCCGATGAC
TGGGTCACGCCGGTGCTGGATTACCGCCTCAAGGACATGATTGAGCTTATGCACGCCTCTTGA
Gene >Ophio5|6210
ATGGCTGGCGGCGGGGATCCCCCAACGGGCCTGGCTTCCCATTCCCCGCCGGAGAGTCCTCCCCTGGAAAGTCCC
CTGGAAAGTCCCCTGAAAAGTCCCCTGGAAAGCTTCCTGGCCTTCAGCCCGAGCGTGCCGGTCACTCCGCTGGAA
AGCCTCCACTCTTACGGTGCTCGTCCCGCTCGGCAGGCGGCGCCGCCCCTGAAGATCATCAACTACGACACCTGG
GTCAAGGTCAAAGGCTACCCTCAGCTGCCGCTATTCCGGCGGCCCGGCTCGAAGAGGCTACGGACGGTCCAGAAG
CTTCGGCGGTGGCAGCCTTCGCCCTGTAAAATGTTTCTCATCTTGCTGGCCGTGGTGCTGGTGGTGTTGGCCGGC
TATATCTGGCGCAAGGAGGCTCGTCTGGCGGCCCGCTGGGAGCCGGACACGGAGTCGCGGCTTTTCAGCGAGAAG
CCTCTCCCGCCGCCTCAGCAGAGCAGCAACATCAGCTCGTACCGGCTCCCGCTGAAGACGCGAGGGCGCGACATC
GTCGACGAGGATGGACGACGCTTCAAGCTCTCGTCGGTCAACTGGTATGGCGCCAGCGACGAGCTCTTCGTGGTG
GGAGGGCTGGAAGTACAACATCGCGACGTGATTGCTCAGACGATGCTGCGCCTGGGCTTCAACAGCGTCCGGCTT
CCGTACTCGGATGAGCTGGTGGCGACGAATCCGGTCGTGGACGCGCGGCAGCTCAGTGCGAACCCGGACCTGATC
GGGAAGCGAGCGCTCGACGTGCTCGAGGTCGTCGTCAAGTCGCTGACGGACGCCGGCTTGGCCGTCATCGTCAAT
AACCACATCACCACGGCCACCTGGTGCTGCGGCATCGATCCCTGCGACTCTGGTTGGGCCAACGACCACCTCGGC
ATGCTGTGCCGGGTCGGCCAGACCGAGGAGCAGTGGATGCGCCATTGGGAGACGGTCATGGCTCGCTTCGTCGAC
AACCCGCGCGTCATCGGCGCCGACCTGCGCAACGAGGTCCGCGGACTATGGGGGACCATGCCCTGGTCTCGCTGG
GCGGCCGCGGCCGAGCGTTGCGGCAACCGGCTGCTCCGGCTTCGATCGGACTGGCTCATCGTCGTCGAAGGAACC
GAGTCGGCCAACGACCTATCGGGCGCGAGGGACCGGCCCATCCGTCTCGACGTCGCCGACCGTCTCGTCTACTCG
GCACACGTCTATGCCTGGTCCGGCTGGGGCAGCCTCGAGGGCCGGTTCGCGCAGCGGGACTACGACTCTTTCGTC
AAGACGATGCGCCACAACTGGGCCTATCTGCTGGATCAGGACATTGCCCCCGTCTGGGTCGGCGAGCTGGGCGCG
CCGCACGAGCCGTCCAACGGTGATGCCCACTACTGGAAAAACCTCTGGCGTTATCTCAAGGCCGTCGACGCCGAC
TTTGGATACTGGGCCATCAACCCGCGGAAGCCTAAGGACAACGAGGTTGAGACGTACTCGATTGTCGCCGATGAC
TGGGTCACGCCGGTGCTGGATTACCGCCTCAAGGACATGATTGAGCTTATGCACGCCTCTTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail