Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|6206
Gene name
Locationscaffold_530:5848..7973
Strand+
Gene length (bp)2125
Transcript length (bp)2019
Coding sequence length (bp)2016
Protein length (aa) 672

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF05277 DUF726 Protein of unknown function (DUF726) 1.4E-84 310 639

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9US10|YK68_SCHPO Uncharacterized membrane protein C6F6.13c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC607.08c PE=3 SV=1 179 641 1.0E-43
sp|Q5TGY1|TMCO4_HUMAN Transmembrane and coiled-coil domain-containing protein 4 OS=Homo sapiens GN=TMCO4 PE=2 SV=1 392 653 2.0E-42
sp|Q91WU4|TMCO4_MOUSE Transmembrane and coiled-coil domain-containing protein 4 OS=Mus musculus GN=Tmco4 PE=2 SV=2 330 663 2.0E-41
sp|Q499U8|TMCO4_RAT Transmembrane and coiled-coil domain-containing protein 4 OS=Rattus norvegicus GN=Tmco4 PE=2 SV=1 330 653 2.0E-39
sp|O14244|YELD_SCHPO Uncharacterized membrane protein C6F6.13c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC6F6.13c PE=3 SV=1 395 658 8.0E-35
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9US10|YK68_SCHPO Uncharacterized membrane protein C6F6.13c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC607.08c PE=3 SV=1 179 641 1.0E-43
sp|Q5TGY1|TMCO4_HUMAN Transmembrane and coiled-coil domain-containing protein 4 OS=Homo sapiens GN=TMCO4 PE=2 SV=1 392 653 2.0E-42
sp|Q91WU4|TMCO4_MOUSE Transmembrane and coiled-coil domain-containing protein 4 OS=Mus musculus GN=Tmco4 PE=2 SV=2 330 663 2.0E-41
sp|Q499U8|TMCO4_RAT Transmembrane and coiled-coil domain-containing protein 4 OS=Rattus norvegicus GN=Tmco4 PE=2 SV=1 330 653 2.0E-39
sp|O14244|YELD_SCHPO Uncharacterized membrane protein C6F6.13c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC6F6.13c PE=3 SV=1 395 658 8.0E-35
sp|Q20035|TMCO4_CAEEL Uncharacterized membrane protein F35D11.3 OS=Caenorhabditis elegans GN=F35D11.3 PE=3 SV=2 390 637 1.0E-30
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|6206
MVRASRGAGHSAFRRTDLTGLISVAERNDLTTLISAIMDKMHNEISCIFDSPPLTPVLVQQEHHHWLSWAILNCA
TVDSDAESPQISGDGSKAFAKAHKIVVKEETEAMTPQLRELKKEALLFFTKWQTAVLHRTREINIHDTSAGNHRG
GRGTRGGFRGRGARGGGGGYGRGGGGNGRGGLTLATGPPRISPAAMDHELAKRFSPTPNTLWALPYEKRKLLLHV
VMLLVLSLQEYGANARILLLNLTSSLNLSFDLYHEDELRISRALAKAALEFTTSKQPNQQLDVKLTSRRWKNCLA
AGSAPNASLAGRLRSDGIGDMQYGPGLPPSAVAGLLGAMAEHAHLLSNLFGMSPVRPLSKMLDNCCRDIQDFALL
RMLDEAHSEYRVASETPATERRLHIAIAMSGFLSQNKHVTEPWKCLGSEAETYVVKWEVDALVHMGVSLETVIKS
LAWKCAKKDISSRFDASKLLDFRWPGQLLKISKIIDIPWSTGIVRAEKAGALLADAIIRHKFQGERSVSLIGYSL
AARAIYTCLMVLAERRQFGLIDSVVMMGTPAPSESRVWLTLKSVVSGRLVNVYSKHDYLLAFLYRTSNLHFGIAG
LHEIQGAYGVENHCVGELPRGHDDYHTLTGRILQDIGWEGVELKPEPQPTPKPAKHSRPQKKPAARRTKSAR
Coding >Ophio5|6206
ATGGTCCGCGCGAGCCGAGGTGCCGGCCATTCGGCCTTTCGTCGTACTGATTTGACTGGGCTCATCTCCGTTGCC
GAAAGAAACGACCTGACAACGCTCATCAGCGCAATCATGGACAAGATGCACAACGAAATCAGCTGCATCTTCGAC
TCCCCCCCCCTCACCCCCGTCCTTGTACAGCAGGAACACCATCACTGGCTGTCTTGGGCCATTCTCAACTGCGCA
ACCGTTGATTCCGATGCCGAGTCGCCTCAGATTTCGGGCGATGGCTCCAAGGCTTTCGCCAAGGCTCACAAAATC
GTCGTCAAGGAGGAGACCGAGGCCATGACGCCTCAGCTTCGTGAGCTGAAGAAGGAAGCCCTCCTCTTCTTCACC
AAGTGGCAGACGGCCGTCCTTCATCGCACTCGCGAGATCAACATCCACGACACGTCTGCCGGCAACCACCGAGGC
GGTCGTGGAACTCGCGGCGGCTTTCGTGGCCGTGGTGCCCGCGGCGGTGGTGGAGGATACGGCCGCGGCGGCGGA
GGAAACGGCCGCGGCGGCTTGACCTTGGCGACGGGACCACCCCGAATCTCTCCGGCTGCCATGGACCACGAGCTA
GCCAAGAGGTTCTCGCCCACTCCCAACACCCTGTGGGCTCTCCCTTACGAAAAGAGAAAGCTTCTGCTTCACGTT
GTCATGTTGCTCGTCTTATCGCTGCAGGAGTACGGAGCGAATGCCCGCATTCTTCTCCTCAACCTCACATCGTCC
CTTAACCTCTCTTTTGACCTATATCACGAGGATGAGCTCCGAATCTCGCGCGCTCTTGCCAAGGCTGCTCTCGAG
TTCACCACCAGCAAGCAGCCTAATCAGCAGCTCGACGTGAAGCTCACCTCTCGTCGATGGAAGAACTGCCTTGCA
GCCGGCTCTGCACCCAACGCCAGCCTTGCTGGACGCCTCAGGTCGGACGGCATCGGAGACATGCAATACGGCCCC
GGGCTACCCCCCAGTGCTGTGGCAGGATTGCTGGGAGCCATGGCGGAGCATGCCCATTTGCTGAGCAACCTCTTT
GGAATGAGTCCTGTCAGGCCCCTCAGCAAGATGCTCGACAACTGCTGCCGGGACATACAGGATTTTGCTCTGCTT
CGTATGCTCGACGAGGCGCACTCCGAGTACCGCGTTGCAAGCGAGACGCCGGCTACGGAACGCAGACTTCACATC
GCCATTGCCATGAGTGGCTTTCTCTCCCAGAACAAGCATGTCACCGAGCCGTGGAAATGCCTCGGTAGCGAGGCC
GAGACGTACGTGGTGAAGTGGGAGGTGGACGCCCTCGTGCACATGGGCGTCTCGCTCGAGACTGTCATCAAGAGT
TTGGCCTGGAAGTGCGCCAAAAAGGATATTTCGTCACGTTTCGATGCCTCGAAACTGTTGGATTTCCGTTGGCCG
GGCCAGCTGCTCAAGATCAGCAAGATCATCGACATTCCATGGAGCACGGGAATAGTGCGAGCCGAGAAGGCGGGC
GCCCTTCTCGCAGATGCCATCATCCGGCACAAGTTCCAGGGAGAGCGCTCCGTCTCTCTCATCGGCTACAGCCTG
GCAGCCCGGGCCATCTACACGTGCCTCATGGTCTTGGCGGAGCGTCGCCAGTTTGGCCTGATCGACTCGGTCGTC
ATGATGGGCACACCGGCGCCGTCGGAGAGTCGGGTTTGGCTCACTCTCAAGAGCGTCGTGTCCGGCCGACTGGTC
AACGTCTACTCCAAGCACGACTACTTGCTGGCCTTCCTGTACCGCACCTCCAACCTCCATTTCGGCATCGCCGGC
CTGCATGAGATTCAAGGGGCGTACGGCGTCGAGAATCACTGCGTCGGGGAGCTACCGCGTGGCCACGACGACTAT
CACACCCTCACCGGCCGCATCCTCCAGGATATCGGATGGGAGGGCGTCGAGCTCAAGCCGGAGCCGCAGCCGACG
CCGAAGCCGGCGAAGCACTCGCGGCCCCAGAAGAAGCCGGCGGCGAGGCGGACCAAGTCAGCCCGG
Transcript >Ophio5|6206
ATGGTCCGCGCGAGCCGAGGTGCCGGCCATTCGGCCTTTCGTCGTACTGATTTGACTGGGCTCATCTCCGTTGCC
GAAAGAAACGACCTGACAACGCTCATCAGCGCAATCATGGACAAGATGCACAACGAAATCAGCTGCATCTTCGAC
TCCCCCCCCCTCACCCCCGTCCTTGTACAGCAGGAACACCATCACTGGCTGTCTTGGGCCATTCTCAACTGCGCA
ACCGTTGATTCCGATGCCGAGTCGCCTCAGATTTCGGGCGATGGCTCCAAGGCTTTCGCCAAGGCTCACAAAATC
GTCGTCAAGGAGGAGACCGAGGCCATGACGCCTCAGCTTCGTGAGCTGAAGAAGGAAGCCCTCCTCTTCTTCACC
AAGTGGCAGACGGCCGTCCTTCATCGCACTCGCGAGATCAACATCCACGACACGTCTGCCGGCAACCACCGAGGC
GGTCGTGGAACTCGCGGCGGCTTTCGTGGCCGTGGTGCCCGCGGCGGTGGTGGAGGATACGGCCGCGGCGGCGGA
GGAAACGGCCGCGGCGGCTTGACCTTGGCGACGGGACCACCCCGAATCTCTCCGGCTGCCATGGACCACGAGCTA
GCCAAGAGGTTCTCGCCCACTCCCAACACCCTGTGGGCTCTCCCTTACGAAAAGAGAAAGCTTCTGCTTCACGTT
GTCATGTTGCTCGTCTTATCGCTGCAGGAGTACGGAGCGAATGCCCGCATTCTTCTCCTCAACCTCACATCGTCC
CTTAACCTCTCTTTTGACCTATATCACGAGGATGAGCTCCGAATCTCGCGCGCTCTTGCCAAGGCTGCTCTCGAG
TTCACCACCAGCAAGCAGCCTAATCAGCAGCTCGACGTGAAGCTCACCTCTCGTCGATGGAAGAACTGCCTTGCA
GCCGGCTCTGCACCCAACGCCAGCCTTGCTGGACGCCTCAGGTCGGACGGCATCGGAGACATGCAATACGGCCCC
GGGCTACCCCCCAGTGCTGTGGCAGGATTGCTGGGAGCCATGGCGGAGCATGCCCATTTGCTGAGCAACCTCTTT
GGAATGAGTCCTGTCAGGCCCCTCAGCAAGATGCTCGACAACTGCTGCCGGGACATACAGGATTTTGCTCTGCTT
CGTATGCTCGACGAGGCGCACTCCGAGTACCGCGTTGCAAGCGAGACGCCGGCTACGGAACGCAGACTTCACATC
GCCATTGCCATGAGTGGCTTTCTCTCCCAGAACAAGCATGTCACCGAGCCGTGGAAATGCCTCGGTAGCGAGGCC
GAGACGTACGTGGTGAAGTGGGAGGTGGACGCCCTCGTGCACATGGGCGTCTCGCTCGAGACTGTCATCAAGAGT
TTGGCCTGGAAGTGCGCCAAAAAGGATATTTCGTCACGTTTCGATGCCTCGAAACTGTTGGATTTCCGTTGGCCG
GGCCAGCTGCTCAAGATCAGCAAGATCATCGACATTCCATGGAGCACGGGAATAGTGCGAGCCGAGAAGGCGGGC
GCCCTTCTCGCAGATGCCATCATCCGGCACAAGTTCCAGGGAGAGCGCTCCGTCTCTCTCATCGGCTACAGCCTG
GCAGCCCGGGCCATCTACACGTGCCTCATGGTCTTGGCGGAGCGTCGCCAGTTTGGCCTGATCGACTCGGTCGTC
ATGATGGGCACACCGGCGCCGTCGGAGAGTCGGGTTTGGCTCACTCTCAAGAGCGTCGTGTCCGGCCGACTGGTC
AACGTCTACTCCAAGCACGACTACTTGCTGGCCTTCCTGTACCGCACCTCCAACCTCCATTTCGGCATCGCCGGC
CTGCATGAGATTCAAGGGGCGTACGGCGTCGAGAATCACTGCGTCGGGGAGCTACCGCGTGGCCACGACGACTAT
CACACCCTCACCGGCCGCATCCTCCAGGATATCGGATGGGAGGGCGTCGAGCTCAAGCCGGAGCCGCAGCCGACG
CCGAAGCCGGCGAAGCACTCGCGGCCCCAGAAGAAGCCGGCGGCGAGGCGGACCAAGTCAGCCCGGTAG
Gene >Ophio5|6206
ATGGTCCGCGCGAGCCGAGGTGCCGGCCATTCGGCCTTTCGTCGTACTGATTTGACTGGGCTCATCTCCGTTGCC
GAAAGAAACGACCTGACAACGCTCATCAGCGCAATCATGGACAAGATGCACAACGAAATCAGCTGCATCTTCGAC
TCCCCCCCCCTCACCCCCGTCCTTGTACAGCAGGAACACCATCACTGGCTGTCTTGGGCCATTCTCAACTGCGCA
ACCGTTGATTCCGATGCCGAGTCGCCTCAGATTTCGGGCGATGGCTCCAAGGCTTTCGCCAAGGCTCACAAAATC
GTCGTCAAGGAGGAGACCGAGGCCATGACGCCTCAGCTTCGTGAGCTGAAGAAGGAAGCCCTCCTCTTCTTCACC
AAGTGGCAGACGGCCGTCCTTCATCGCACTCGCGAGATCAACATCCACGACACGTCTGCCGGCAACCACCGAGGC
GGTCGTGGAACTCGCGGCGGCTTTCGTGGCCGTGGTGCCCGCGGCGGTGGTGGAGGATACGGCCGCGGCGGCGGA
GGAAACGGCCGCGGCGGCTTGACCTTGGCGACGGGTAAGAGGACTGGCCGTCGCCGCTACTCCTTCACCTTGGAG
ACTGACGAGCCGGTAGGACCACCCCGAATCTCTCCGGCTGCCATGGACCACGAGCTAGCCAAGAGGTTCTCGCCC
ACTCCCAACACCCTGTGGGCTCTCCCTTACGAAAAGAGAAAGCTTCTGCTTCACGTTGTCATGTTGCTCGTCTTA
TCGCTGCAGGAGTACGGAGCGAATGCCCGCATTCTTCTCCTCAACCTCACATCGTCCCTTAACCTCTCTTTTGAC
CTATATCACGAGGATGAGCTCCGAATCTCGCGCGCTCTTGCCAAGGCTGCTCTCGAGTTCACCACCAGCAAGCAG
CCTAATCAGCAGCTCGACGTGAAGCTCACCTCTCGTCGATGGAAGAACTGCCTTGCAGCCGGCTCTGCACCCAAC
GCCAGCCTTGCTGGACGCCTCAGGTCGGACGGCATCGGAGACATGCAATACGGCCCCGGGCTACCCCCCAGTGCT
GTGGCAGGATTGCTGGGAGCCATGGCGGAGCATGCCCATTTGCTGAGCAACCTCTTTGGAATGAGTCCTGTCAGG
CCCCTCAGCAAGATGCTCGACAACTGCTGCCGGGACATACAGGATTTTGCTCTGCTTCGTATGCTCGACGAGGCG
CACTCCGAGTACCGCGTTGCAAGCGAGACGCCGGCTACGGAACGCAGACTTCACATCGCCATTGCCATGAGTGGC
TTTCTCTCCCAGAACAAGCATGTCACCGAGCCGTGGAAATGCCTCGGTAGCGAGGCCGAGACGTACGTGGTGAAG
TGGGAGGTGGACGCCCTCGTGCACATGGGCGTCTCGCTCGAGACTGTCATCAAGAGTTTGGCCTGGAAGTGCGCC
AAAAAGGATATTTCGTCACGTTTCGGTAAGCGAGCAGATTGACCGCTTCCGTGCCACGAGGCTAACGTTGCCAGA
TGCCTCGAAACTGTTGGATTTCCGTTGGCCGGGCCAGCTGCTCAAGATCAGCAAGATCATCGACATTCCATGGAG
CACGGGAATAGTGCGAGCCGAGAAGGCGGGCGCCCTTCTCGCAGATGCCATCATCCGGCACAAGTTCCAGGGAGA
GCGCTCCGTCTCTCTCATCGGCTACAGCCTGGCAGCCCGGGCCATCTACACGTGCCTCATGGTCTTGGCGGAGCG
TCGCCAGTTTGGCCTGATCGACTCGGTCGTCATGATGGGCACACCGGCGCCGTCGGAGAGTCGGGTTTGGCTCAC
TCTCAAGAGCGTCGTGTCCGGCCGACTGGTCAACGTCTACTCCAAGCACGACTACTTGCTGGCCTTCCTGTACCG
CACCTCCAACCTCCATTTCGGCATCGCCGGCCTGCATGAGATTCAAGGGGCGTACGGCGTCGAGAATCACTGCGT
CGGGGAGCTACCGCGTGGCCACGACGACTATCACACCCTCACCGGCCGCATCCTCCAGGATATCGGATGGGAGGG
CGTCGAGCTCAAGCCGGAGCCGCAGCCGACGCCGAAGCCGGCGAAGCACTCGCGGCCCCAGAAGAAGCCGGCGGC
GAGGCGGACCAAGTCAGCCCGGTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail