Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|6204
Gene name
Locationscaffold_530:1097..2411
Strand-
Gene length (bp)1314
Transcript length (bp)1260
Coding sequence length (bp)1257
Protein length (aa) 419

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

(None)

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm|Nucleus Nuclear localization signal 0.5174 0.903 0.0202 0.0422 0.0674 0.003 0.0436 0.0242 0.016 0.0551

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup1975
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|5611
Ophiocordyceps australis map64 (Brazil) OphauB2|3256
Ophiocordyceps camponoti-floridani Ophcf2|06662
Ophiocordyceps camponoti-rufipedis Ophun1|6034
Ophiocordyceps kimflemingae Ophio5|6204 (this protein)
Ophiocordyceps subramaniannii Hirsu2|217

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|6204
MVQQYRPGGLKRPRLSLQIRTTTRTGRPVDAGDPTAFNTLSNAYVAAIETSSALPSEPMTAINTLQAFSIGTPAE
CKEAIPRVVTPYVASYPETPLTAQPMSPSRLELHYPSTMTATPPLSAESADAASSSFTFSPSDISCSPRPDCGSS
LVAARRLPQMADLQPPYSHPRSLHSILRNSPLPPRTAIPPPSPRRQSLRLQEKAAKKSHMELLAEDTSPSSPCLT
VESASVPLLGVTNNQVQGGIFPAQPAFPSATGSDDGMAGSEAQSSAESACGRKRRRTEKKRRWVWTIGQNDDEDE
SHMAADAAGGDLIRTPHTTMTTLGDDAETPTASIESSVDTESASSVMGSVVDASASDTCSVDWADEEEESPDADA
ASETGIDLKTPTAPRRLAGGVVKQDTPIPDLLRSRDTPVPPELV
Coding >Ophio5|6204
ATGGTTCAGCAGTATCGCCCGGGAGGCCTGAAGCGGCCACGGCTGTCTCTCCAGATTAGGACGACGACGAGGACG
GGCCGTCCCGTCGATGCCGGCGACCCGACGGCCTTCAATACACTGTCCAATGCCTACGTGGCCGCCATCGAAACA
TCGTCGGCCCTACCGTCGGAACCCATGACGGCAATTAACACGCTGCAAGCATTCAGCATTGGGACACCGGCAGAG
TGCAAGGAGGCCATACCCCGTGTCGTCACGCCCTACGTGGCCTCGTACCCGGAGACGCCCCTGACGGCACAGCCC
ATGTCACCCTCTCGGCTCGAGCTACACTACCCCAGCACCATGACGGCCACGCCGCCCCTATCGGCCGAATCTGCC
GACGCGGCCTCGTCATCCTTTACCTTTTCTCCCTCTGACATCTCATGCTCGCCACGGCCCGATTGCGGCAGCTCG
CTGGTCGCAGCGCGGAGGCTTCCGCAGATGGCCGACCTGCAACCCCCTTACTCGCACCCCCGGAGCCTGCACAGC
ATTCTTCGCAACTCTCCGCTTCCCCCGCGGACGGCCATTCCTCCGCCATCGCCGAGGAGGCAGTCTCTGCGTCTG
CAGGAGAAGGCGGCCAAGAAGTCCCACATGGAACTTCTTGCCGAAGACACGTCTCCCAGCTCGCCGTGCTTGACG
GTCGAGTCCGCCAGCGTGCCGCTGCTCGGTGTGACGAATAACCAAGTCCAGGGCGGCATTTTTCCAGCACAACCG
GCCTTTCCTTCCGCCACAGGGAGTGATGACGGGATGGCCGGCTCGGAGGCGCAGTCATCGGCGGAATCCGCATGC
GGTCGTAAACGTAGGCGAACGGAGAAGAAGCGTCGATGGGTCTGGACTATCGGACAGAATGACGACGAGGACGAA
AGCCACATGGCAGCCGACGCCGCCGGAGGTGACCTGATACGGACGCCGCACACTACTATGACGACGCTTGGCGAC
GACGCGGAAACGCCAACGGCCAGTATCGAGAGCAGCGTCGACACGGAGAGCGCAAGTTCGGTCATGGGTTCCGTC
GTCGACGCCAGCGCGTCCGACACGTGCAGCGTAGACTGGGCCGACGAGGAGGAAGAGAGTCCGGACGCGGACGCA
GCAAGCGAGACGGGAATCGACTTGAAGACGCCAACGGCGCCGCGTCGTCTTGCCGGCGGGGTTGTGAAGCAGGAC
ACGCCCATCCCGGACTTGCTTCGGAGCCGGGACACGCCGGTGCCGCCGGAGCTGGTG
Transcript >Ophio5|6204
ATGGTTCAGCAGTATCGCCCGGGAGGCCTGAAGCGGCCACGGCTGTCTCTCCAGATTAGGACGACGACGAGGACG
GGCCGTCCCGTCGATGCCGGCGACCCGACGGCCTTCAATACACTGTCCAATGCCTACGTGGCCGCCATCGAAACA
TCGTCGGCCCTACCGTCGGAACCCATGACGGCAATTAACACGCTGCAAGCATTCAGCATTGGGACACCGGCAGAG
TGCAAGGAGGCCATACCCCGTGTCGTCACGCCCTACGTGGCCTCGTACCCGGAGACGCCCCTGACGGCACAGCCC
ATGTCACCCTCTCGGCTCGAGCTACACTACCCCAGCACCATGACGGCCACGCCGCCCCTATCGGCCGAATCTGCC
GACGCGGCCTCGTCATCCTTTACCTTTTCTCCCTCTGACATCTCATGCTCGCCACGGCCCGATTGCGGCAGCTCG
CTGGTCGCAGCGCGGAGGCTTCCGCAGATGGCCGACCTGCAACCCCCTTACTCGCACCCCCGGAGCCTGCACAGC
ATTCTTCGCAACTCTCCGCTTCCCCCGCGGACGGCCATTCCTCCGCCATCGCCGAGGAGGCAGTCTCTGCGTCTG
CAGGAGAAGGCGGCCAAGAAGTCCCACATGGAACTTCTTGCCGAAGACACGTCTCCCAGCTCGCCGTGCTTGACG
GTCGAGTCCGCCAGCGTGCCGCTGCTCGGTGTGACGAATAACCAAGTCCAGGGCGGCATTTTTCCAGCACAACCG
GCCTTTCCTTCCGCCACAGGGAGTGATGACGGGATGGCCGGCTCGGAGGCGCAGTCATCGGCGGAATCCGCATGC
GGTCGTAAACGTAGGCGAACGGAGAAGAAGCGTCGATGGGTCTGGACTATCGGACAGAATGACGACGAGGACGAA
AGCCACATGGCAGCCGACGCCGCCGGAGGTGACCTGATACGGACGCCGCACACTACTATGACGACGCTTGGCGAC
GACGCGGAAACGCCAACGGCCAGTATCGAGAGCAGCGTCGACACGGAGAGCGCAAGTTCGGTCATGGGTTCCGTC
GTCGACGCCAGCGCGTCCGACACGTGCAGCGTAGACTGGGCCGACGAGGAGGAAGAGAGTCCGGACGCGGACGCA
GCAAGCGAGACGGGAATCGACTTGAAGACGCCAACGGCGCCGCGTCGTCTTGCCGGCGGGGTTGTGAAGCAGGAC
ACGCCCATCCCGGACTTGCTTCGGAGCCGGGACACGCCGGTGCCGCCGGAGCTGGTGTGA
Gene >Ophio5|6204
ATGGTTCAGCAGTATCGCCCGGGAGGCCTGAAGCGGCCACGGCTGTCTCTCCAGATTAGGACGACGACGAGGACG
GGCCGTCCCGTCGATGCCGGCGACCCGACGGCCTTCAATACACTGTCCAATGCCTACGTGGCCGCCATCGAAACA
TCGTCGGCCCTACCGTCGGAACCCATGACGGCAATTAACACGCTGCAAGCATTCAGCATTGGGACACCGGCAGAG
TGCAAGGAGGCCATACCCCGTGTCGTCACGCCCTACGTGGCCTCGTACCCGGAGACGCCCCTGACGGCACAGCCC
ATGTCACCCTCTCGGCTCGAGCTACACTACCCCAGCACCATGACGGCCACGCCGCCCCTATCGGCCGAATCTGCC
GACGCGGCCTCGTCATCCTTTACCTTTTCTCCCTCTGACATCTCATGCTCGCCACGGCCCGATTGCGGCAGCTCG
CTGGTCGCAGCGCGGAGGCTTCCGCAGATGGCCGACCTGCAACCCCCTTACTCGCACCCCCGGAGCCTGCACAGC
ATTCTTCGCAACTCTCCGCTTCCCCCGCGGACGGCCATTCCTCCGCCATCGCCGAGGAGGCAGTCTCTGCGTCTG
CAGGAGAAGGCGGCCAAGAAGGTGGGCTACAACAGCCCGCTAACGCAAGAGATTGTCACCAACGAGTACACGAAG
TCCCACATGGAACTTCTTGCCGAAGACACGTCTCCCAGCTCGCCGTGCTTGACGGTCGAGTCCGCCAGCGTGCCG
CTGCTCGGTGTGACGAATAACCAAGTCCAGGGCGGCATTTTTCCAGCACAACCGGCCTTTCCTTCCGCCACAGGG
AGTGATGACGGGATGGCCGGCTCGGAGGCGCAGTCATCGGCGGAATCCGCATGCGGTCGTAAACGTAGGCGAACG
GAGAAGAAGCGTCGATGGGTCTGGACTATCGGACAGAATGACGACGAGGACGAAAGCCACATGGCAGCCGACGCC
GCCGGAGGTGACCTGATACGGACGCCGCACACTACTATGACGACGCTTGGCGACGACGCGGAAACGCCAACGGCC
AGTATCGAGAGCAGCGTCGACACGGAGAGCGCAAGTTCGGTCATGGGTTCCGTCGTCGACGCCAGCGCGTCCGAC
ACGTGCAGCGTAGACTGGGCCGACGAGGAGGAAGAGAGTCCGGACGCGGACGCAGCAAGCGAGACGGGAATCGAC
TTGAAGACGCCAACGGCGCCGCGTCGTCTTGCCGGCGGGGTTGTGAAGCAGGACACGCCCATCCCGGACTTGCTT
CGGAGCCGGGACACGCCGGTGCCGCCGGAGCTGGTGTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail