Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|62
Gene name
Locationscaffold_1:154190..155335
Strand-
Gene length (bp)1145
Transcript length (bp)1086
Coding sequence length (bp)1083
Protein length (aa) 361

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF08213 COX24_C Mitochondrial mRNA-processing protein COX24, C-terminal 2.0E-07 328 357

Swissprot hits

(None)

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Mitochondrion Mitochondrial transit peptide 0.1289 0.1702 0.0461 0.0776 0.9299 0.0081 0.0459 0.014 0.032 0.0052

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup4608
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|2460
Ophiocordyceps australis map64 (Brazil) OphauB2|4463
Ophiocordyceps camponoti-floridani Ophcf2|03344
Ophiocordyceps camponoti-rufipedis Ophun1|6807
Ophiocordyceps kimflemingae Ophio5|62 (this protein)
Ophiocordyceps subramaniannii Hirsu2|9666

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|62
MLPFSVRRAVAAVPLGLGSALGPAAPLMAQRRASSSKPSRPDNDSSDVPADRPVASKPTDRPVAAAKPADRPANA
SPADRTATASPASSRPDAKQASDKPSGDKPAGDKRKRKPKETIPKNLPYVSETRHITKDDLGLSAFFSQHRPISI
TQSIPKPVTNEQFASIFSPRMKNNKSVATPLANPFDRLESSMSQMTIGAHQQQDGGDPATVVRNADGTTSGFYLD
IDAMAGDFLPFRPPPLPQPTVSADAPATADAAANPASTQDAPQYRKYRAIFTIEETVEPDGQYRVVAHSPRIVRG
PSERSFLERMARRQLRFEEAQAGRAMHAISVRRQRKLKMKKKKYKKLQKRTRNSRRKNERS
Coding >Ophio5|62
ATGTTGCCCTTTTCGGTGCGACGCGCCGTCGCGGCGGTTCCCCTCGGCTTGGGCTCGGCTCTGGGCCCTGCCGCT
CCGCTCATGGCTCAGCGAAGGGCCTCATCGTCCAAGCCGTCGAGGCCCGATAACGATTCCAGCGACGTCCCGGCC
GATCGTCCGGTCGCTTCCAAGCCCACCGACCGCCCCGTTGCCGCCGCCAAGCCGGCCGACCGCCCTGCTAACGCT
TCGCCGGCCGACCGCACTGCTACCGCCTCGCCGGCCTCGTCGCGTCCCGACGCGAAGCAGGCCAGCGACAAGCCC
AGTGGTGACAAGCCGGCCGGCGACAAGCGCAAGCGGAAACCGAAGGAAACGATCCCTAAGAACCTGCCCTATGTC
TCCGAAACTCGCCACATAACCAAGGATGACCTGGGCTTGTCTGCCTTCTTTTCCCAGCATCGACCCATCTCCATC
ACGCAGTCGATACCGAAGCCCGTCACCAATGAGCAATTTGCCTCCATCTTCTCTCCGCGCATGAAAAACAATAAA
TCGGTTGCTACGCCCCTAGCAAACCCCTTTGACAGGCTGGAGAGCTCCATGTCGCAGATGACGATAGGCGCCCAT
CAACAACAAGACGGCGGCGACCCCGCGACTGTTGTCAGAAATGCCGACGGCACCACGTCGGGCTTCTACCTCGAC
ATCGACGCCATGGCCGGCGACTTCCTCCCTTTCCGCCCGCCCCCCCTCCCGCAGCCGACGGTGTCTGCCGATGCT
CCGGCGACAGCTGACGCGGCGGCCAACCCGGCCTCAACCCAGGACGCGCCCCAATACCGCAAGTACCGGGCCATC
TTCACCATTGAGGAAACCGTCGAGCCCGACGGCCAGTATCGCGTCGTGGCTCACAGCCCACGCATCGTCCGCGGC
CCCTCGGAGCGCAGTTTTCTCGAGCGCATGGCGCGGCGACAACTTCGCTTCGAAGAGGCTCAGGCCGGCCGAGCC
ATGCATGCCATCAGCGTCAGACGGCAACGGAAGCTCAAGATGAAGAAAAAGAAGTATAAGAAGCTGCAGAAGCGC
ACGCGCAATTCGCGCCGCAAGAATGAGCGGTCG
Transcript >Ophio5|62
ATGTTGCCCTTTTCGGTGCGACGCGCCGTCGCGGCGGTTCCCCTCGGCTTGGGCTCGGCTCTGGGCCCTGCCGCT
CCGCTCATGGCTCAGCGAAGGGCCTCATCGTCCAAGCCGTCGAGGCCCGATAACGATTCCAGCGACGTCCCGGCC
GATCGTCCGGTCGCTTCCAAGCCCACCGACCGCCCCGTTGCCGCCGCCAAGCCGGCCGACCGCCCTGCTAACGCT
TCGCCGGCCGACCGCACTGCTACCGCCTCGCCGGCCTCGTCGCGTCCCGACGCGAAGCAGGCCAGCGACAAGCCC
AGTGGTGACAAGCCGGCCGGCGACAAGCGCAAGCGGAAACCGAAGGAAACGATCCCTAAGAACCTGCCCTATGTC
TCCGAAACTCGCCACATAACCAAGGATGACCTGGGCTTGTCTGCCTTCTTTTCCCAGCATCGACCCATCTCCATC
ACGCAGTCGATACCGAAGCCCGTCACCAATGAGCAATTTGCCTCCATCTTCTCTCCGCGCATGAAAAACAATAAA
TCGGTTGCTACGCCCCTAGCAAACCCCTTTGACAGGCTGGAGAGCTCCATGTCGCAGATGACGATAGGCGCCCAT
CAACAACAAGACGGCGGCGACCCCGCGACTGTTGTCAGAAATGCCGACGGCACCACGTCGGGCTTCTACCTCGAC
ATCGACGCCATGGCCGGCGACTTCCTCCCTTTCCGCCCGCCCCCCCTCCCGCAGCCGACGGTGTCTGCCGATGCT
CCGGCGACAGCTGACGCGGCGGCCAACCCGGCCTCAACCCAGGACGCGCCCCAATACCGCAAGTACCGGGCCATC
TTCACCATTGAGGAAACCGTCGAGCCCGACGGCCAGTATCGCGTCGTGGCTCACAGCCCACGCATCGTCCGCGGC
CCCTCGGAGCGCAGTTTTCTCGAGCGCATGGCGCGGCGACAACTTCGCTTCGAAGAGGCTCAGGCCGGCCGAGCC
ATGCATGCCATCAGCGTCAGACGGCAACGGAAGCTCAAGATGAAGAAAAAGAAGTATAAGAAGCTGCAGAAGCGC
ACGCGCAATTCGCGCCGCAAGAATGAGCGGTCGTGA
Gene >Ophio5|62
ATGTTGCCCTTTTCGGTGCGACGCGCCGTCGCGGCGGTTCCCCTCGGCTTGGGCTCGGCTCTGGGCCCTGCCGCT
CCGCTCATGGCTCAGCGAAGGGCCTCATCGTCCAAGCCGTCGAGGCCCGATAACGATTCCAGCGACGTCCCGGCC
GATCGTCCGGTCGCTTCCAAGCCCACCGACCGCCCCGTTGCCGCCGCCAAGCCGGCCGACCGCCCTGCTAACGCT
TCGCCGGCCGACCGCACTGCTACCGCCTCGCCGGCCTCGTCGCGTCCCGACGCGAAGCAGGCCAGCGACAAGCCC
AGTGGTGACAAGCCGGCCGGCGACAAGCGCAAGCGGAAACCGAAGGAAACGATCCCTAAGAACCTGCCCTATGTC
TCCGAAACTCGCCACATAACCAAGGATGGTGAGTGATCATGTCATGTAGCGTGCCCCCCTTCCCTCGACTGACCC
AGCTCGCTGCAGACCTGGGCTTGTCTGCCTTCTTTTCCCAGCATCGACCCATCTCCATCACGCAGTCGATACCGA
AGCCCGTCACCAATGAGCAATTTGCCTCCATCTTCTCTCCGCGCATGAAAAACAATAAATCGGTTGCTACGCCCC
TAGCAAACCCCTTTGACAGGCTGGAGAGCTCCATGTCGCAGATGACGATAGGCGCCCATCAACAACAAGACGGCG
GCGACCCCGCGACTGTTGTCAGAAATGCCGACGGCACCACGTCGGGCTTCTACCTCGACATCGACGCCATGGCCG
GCGACTTCCTCCCTTTCCGCCCGCCCCCCCTCCCGCAGCCGACGGTGTCTGCCGATGCTCCGGCGACAGCTGACG
CGGCGGCCAACCCGGCCTCAACCCAGGACGCGCCCCAATACCGCAAGTACCGGGCCATCTTCACCATTGAGGAAA
CCGTCGAGCCCGACGGCCAGTATCGCGTCGTGGCTCACAGCCCACGCATCGTCCGCGGCCCCTCGGAGCGCAGTT
TTCTCGAGCGCATGGCGCGGCGACAACTTCGCTTCGAAGAGGCTCAGGCCGGCCGAGCCATGCATGCCATCAGCG
TCAGACGGCAACGGAAGCTCAAGATGAAGAAAAAGAAGTATAAGAAGCTGCAGAAGCGCACGCGCAATTCGCGCC
GCAAGAATGAGCGGTCGTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail