Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|6194
Gene name
Locationscaffold_53:29119..30507
Strand-
Gene length (bp)1388
Transcript length (bp)852
Coding sequence length (bp)849
Protein length (aa) 283

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01459 Porin_3 Eukaryotic porin 2.9E-67 4 276

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P07144|VDAC_NEUCR Mitochondrial outer membrane protein porin OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=B7H23.070 PE=2 SV=1 1 282 2.0E-168
sp|P83781|VDAC_CANAL Mitochondrial outer membrane protein porin OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=POR1 PE=1 SV=2 1 281 3.0E-94
sp|Q9P544|VDAC_SCHPO Probable mitochondrial outer membrane protein porin OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC1635.01 PE=3 SV=1 1 281 1.0E-70
sp|P04840|VDAC1_YEAST Mitochondrial outer membrane protein porin 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=POR1 PE=1 SV=4 1 282 4.0E-61
sp|P40478|VDAC2_YEAST Mitochondrial outer membrane protein porin 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=POR2 PE=1 SV=1 1 281 2.0E-46
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P07144|VDAC_NEUCR Mitochondrial outer membrane protein porin OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=B7H23.070 PE=2 SV=1 1 282 2.0E-168
sp|P83781|VDAC_CANAL Mitochondrial outer membrane protein porin OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=POR1 PE=1 SV=2 1 281 3.0E-94
sp|Q9P544|VDAC_SCHPO Probable mitochondrial outer membrane protein porin OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC1635.01 PE=3 SV=1 1 281 1.0E-70
sp|P04840|VDAC1_YEAST Mitochondrial outer membrane protein porin 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=POR1 PE=1 SV=4 1 282 4.0E-61
sp|P40478|VDAC2_YEAST Mitochondrial outer membrane protein porin 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=POR2 PE=1 SV=1 1 281 2.0E-46
sp|Q94920|VDAC_DROME Voltage-dependent anion-selective channel OS=Drosophila melanogaster GN=porin PE=1 SV=3 1 282 5.0E-41
sp|P21796|VDAC1_HUMAN Voltage-dependent anion-selective channel protein 1 OS=Homo sapiens GN=VDAC1 PE=1 SV=2 4 282 1.0E-37
sp|Q9TT15|VDAC1_RABIT Voltage-dependent anion-selective channel protein 1 OS=Oryctolagus cuniculus GN=VDAC1 PE=2 SV=3 4 282 2.0E-37
sp|P45879|VDAC1_BOVIN Voltage-dependent anion-selective channel protein 1 OS=Bos taurus GN=VDAC1 PE=1 SV=3 4 282 2.0E-37
sp|Q9Z2L0|VDAC1_RAT Voltage-dependent anion-selective channel protein 1 OS=Rattus norvegicus GN=Vdac1 PE=1 SV=4 4 282 2.0E-37
sp|Q60932|VDAC1_MOUSE Voltage-dependent anion-selective channel protein 1 OS=Mus musculus GN=Vdac1 PE=1 SV=3 4 282 3.0E-37
sp|Q9MZ16|VDAC1_PIG Voltage-dependent anion-selective channel protein 1 OS=Sus scrofa GN=VDAC1 PE=2 SV=3 4 282 3.0E-37
sp|P81004|VDAC2_XENLA Voltage-dependent anion-selective channel protein 2 OS=Xenopus laevis GN=vdac2 PE=1 SV=1 4 282 2.0E-36
sp|P68003|VDAC2_RABIT Voltage-dependent anion-selective channel protein 2 OS=Oryctolagus cuniculus GN=VDAC2 PE=2 SV=1 4 282 9.0E-36
sp|P68002|VDAC2_BOVIN Voltage-dependent anion-selective channel protein 2 OS=Bos taurus GN=VDAC2 PE=2 SV=2 4 282 1.0E-35
sp|Q9MZ15|VDAC2_PIG Voltage-dependent anion-selective channel protein 2 OS=Sus scrofa GN=VDAC2 PE=2 SV=1 4 282 1.0E-35
sp|P81155|VDAC2_RAT Voltage-dependent anion-selective channel protein 2 OS=Rattus norvegicus GN=Vdac2 PE=1 SV=2 4 282 2.0E-35
sp|Q60930|VDAC2_MOUSE Voltage-dependent anion-selective channel protein 2 OS=Mus musculus GN=Vdac2 PE=1 SV=2 4 282 2.0E-35
sp|P45880|VDAC2_HUMAN Voltage-dependent anion-selective channel protein 2 OS=Homo sapiens GN=VDAC2 PE=1 SV=2 4 282 3.0E-35
sp|P82013|VDAC2_MELGA Voltage-dependent anion-selective channel protein 2 OS=Meleagris gallopavo GN=VDAC2 PE=1 SV=1 4 282 3.0E-35
sp|Q9TT13|VDAC3_RABIT Voltage-dependent anion-selective channel protein 3 OS=Oryctolagus cuniculus GN=VDAC3 PE=2 SV=1 3 282 2.0E-33
sp|Q60931|VDAC3_MOUSE Voltage-dependent anion-selective channel protein 3 OS=Mus musculus GN=Vdac3 PE=1 SV=1 3 282 3.0E-33
sp|Q9MZ13|VDAC3_BOVIN Voltage-dependent anion-selective channel protein 3 OS=Bos taurus GN=VDAC3 PE=2 SV=1 3 282 3.0E-33
sp|Q29380|VDAC3_PIG Voltage-dependent anion-selective channel protein 3 OS=Sus scrofa GN=VDAC3 PE=2 SV=2 3 282 3.0E-33
sp|Q9Y277|VDAC3_HUMAN Voltage-dependent anion-selective channel protein 3 OS=Homo sapiens GN=VDAC3 PE=1 SV=1 3 282 1.0E-32
sp|Q9R1Z0|VDAC3_RAT Voltage-dependent anion-selective channel protein 3 OS=Rattus norvegicus GN=Vdac3 PE=1 SV=2 1 282 2.0E-32
sp|Q5R7V4|VDAC3_PONAB Voltage-dependent anion-selective channel protein 3 OS=Pongo abelii GN=VDAC3 PE=2 SV=1 3 282 1.0E-31
sp|Q21752|VDAC_CAEEL Probable voltage-dependent anion-selective channel OS=Caenorhabditis elegans GN=vdac-1 PE=3 SV=2 1 282 4.0E-24
sp|Q84P97|VDAC5_ORYSJ Mitochondrial outer membrane protein porin 5 OS=Oryza sativa subsp. japonica GN=VDAC5 PE=2 SV=1 6 270 9.0E-15
sp|Q6L5I5|VDAC2_ORYSJ Mitochondrial outer membrane protein porin 2 OS=Oryza sativa subsp. japonica GN=VDAC2 PE=2 SV=1 6 282 3.0E-14
sp|Q6K548|VDAC1_ORYSJ Mitochondrial outer membrane protein porin 1 OS=Oryza sativa subsp. japonica GN=VDAC1 PE=1 SV=3 6 272 1.0E-11
sp|P42057|VDAC_MAIZE Outer plastidial membrane protein porin OS=Zea mays GN=POR1 PE=2 SV=1 1 282 2.0E-11
sp|Q9FKM2|VDAC4_ARATH Mitochondrial outer membrane protein porin 4 OS=Arabidopsis thaliana GN=VDAC4 PE=1 SV=1 2 282 2.0E-09
sp|Q9FJX3|VDAC2_ARATH Mitochondrial outer membrane protein porin 2 OS=Arabidopsis thaliana GN=VDAC2 PE=1 SV=1 6 270 5.0E-09
sp|Q7F4F8|VDAC3_ORYSJ Mitochondrial outer membrane protein porin 3 OS=Oryza sativa subsp. japonica GN=VDAC3 PE=2 SV=1 6 282 8.0E-09
sp|Q9SRH5|VDAC1_ARATH Mitochondrial outer membrane protein porin 1 OS=Arabidopsis thaliana GN=VDAC1 PE=1 SV=3 6 271 3.0E-08
sp|P46274|VDAC1_WHEAT Mitochondrial outer membrane porin OS=Triticum aestivum GN=VDAC1 PE=2 SV=1 6 244 8.0E-08
sp|Q10S27|VDAC6_ORYSJ Mitochondrial outer membrane protein porin 6 OS=Oryza sativa subsp. japonica GN=VDAC6 PE=2 SV=1 2 264 1.0E-07
sp|Q0JJV1|VDAC4_ORYSJ Mitochondrial outer membrane protein porin 4 OS=Oryza sativa subsp. japonica GN=VDAC4 PE=3 SV=3 8 282 3.0E-07
sp|P42056|VDAC2_SOLTU Mitochondrial outer membrane protein porin of 36 kDa OS=Solanum tuberosum PE=1 SV=2 6 271 3.0E-06
sp|P42055|VDAC1_SOLTU Mitochondrial outer membrane protein porin of 34 kDa OS=Solanum tuberosum PE=1 SV=2 6 270 3.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0005741 mitochondrial outer membrane Yes
GO:0055085 transmembrane transport Yes
GO:0019867 outer membrane No
GO:0098588 bounding membrane of organelle No
GO:0009987 cellular process No
GO:0051234 establishment of localization No
GO:0006810 transport No
GO:0110165 cellular anatomical entity No
GO:0016020 membrane No
GO:0031966 mitochondrial membrane No
GO:0005575 cellular_component No
GO:0031968 organelle outer membrane No
GO:0051179 localization No
GO:0008150 biological_process No
GO:0031090 organelle membrane No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Mitochondrion 0.2717 0.1191 0.0917 0.1527 0.7467 0.0603 0.2733 0.0634 0.0376 0.033

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup4269
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|4645
Ophiocordyceps australis map64 (Brazil) OphauB2|7244
Ophiocordyceps camponoti-floridani Ophcf2|00711
Ophiocordyceps camponoti-rufipedis Ophun1|4769
Ophiocordyceps kimflemingae Ophio5|6194 (this protein)
Ophiocordyceps subramaniannii Hirsu2|8727

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|6194
MPVPAFSDLAKPANDLLNKDFYHLSASTFEFKDTAPNGVAFKITGKSSHDKVTSAAIEGKYVDKPTGLTLTQTWN
TANSLDTKLEVSDSLAKGLKLEGLFNFLPATAARNAKFNLMFKQPNFHGRAFFDLLKGPTANVDAVIGHEGFLAG
ASAGYDVNKAAVTAYSAAVGYSVPSYSAAITATENLSTFSACYYHKVNSQVEAGAKAIWNSKTGNAVGLEIAGKY
RIDPVSFAKVKINDRGIAALAYNVLLREGVTLGLGGSFDTQKLDQATHKLGASFTFEG
Coding >Ophio5|6194
ATGCCTGTTCCCGCCTTCTCGGATCTTGCCAAACCGGCTAACGATCTCCTTAACAAGGATTTCTATCATCTGTCT
GCTTCGACGTTCGAGTTCAAGGACACGGCTCCGAATGGCGTCGCCTTTAAGATCACGGGAAAGTCGAGCCACGAT
AAGGTCACGTCGGCGGCGATCGAGGGCAAATACGTCGACAAGCCTACCGGCCTTACGCTGACGCAGACATGGAAC
ACGGCCAACTCGCTCGATACCAAGCTCGAGGTCAGCGACTCGTTGGCAAAGGGTCTCAAGCTCGAGGGTCTCTTC
AACTTTTTGCCCGCTACCGCTGCCCGGAATGCAAAGTTCAACCTCATGTTCAAGCAGCCCAACTTCCACGGCCGC
GCCTTCTTTGACCTGCTCAAGGGCCCTACGGCCAATGTGGACGCCGTCATCGGCCATGAGGGCTTCTTGGCCGGC
GCTAGCGCTGGTTACGACGTCAACAAGGCTGCCGTCACGGCGTACAGCGCCGCTGTCGGATACTCGGTGCCGTCG
TATAGTGCTGCTATCACGGCTACCGAGAATCTGAGCACCTTTTCTGCTTGCTACTACCACAAGGTTAACAGCCAG
GTCGAGGCTGGCGCCAAGGCCATCTGGAACTCCAAGACGGGCAATGCGGTTGGTCTCGAGATCGCCGGCAAGTAC
CGTATCGATCCTGTGTCCTTTGCCAAGGTCAAGATCAACGACCGCGGCATCGCCGCCCTCGCCTACAACGTTCTT
CTCCGTGAAGGCGTCACCCTCGGTCTCGGTGGCTCCTTTGATACCCAGAAGCTCGACCAGGCGACGCACAAGCTC
GGTGCCAGCTTCACATTTGAAGGC
Transcript >Ophio5|6194
ATGCCTGTTCCCGCCTTCTCGGATCTTGCCAAACCGGCTAACGATCTCCTTAACAAGGATTTCTATCATCTGTCT
GCTTCGACGTTCGAGTTCAAGGACACGGCTCCGAATGGCGTCGCCTTTAAGATCACGGGAAAGTCGAGCCACGAT
AAGGTCACGTCGGCGGCGATCGAGGGCAAATACGTCGACAAGCCTACCGGCCTTACGCTGACGCAGACATGGAAC
ACGGCCAACTCGCTCGATACCAAGCTCGAGGTCAGCGACTCGTTGGCAAAGGGTCTCAAGCTCGAGGGTCTCTTC
AACTTTTTGCCCGCTACCGCTGCCCGGAATGCAAAGTTCAACCTCATGTTCAAGCAGCCCAACTTCCACGGCCGC
GCCTTCTTTGACCTGCTCAAGGGCCCTACGGCCAATGTGGACGCCGTCATCGGCCATGAGGGCTTCTTGGCCGGC
GCTAGCGCTGGTTACGACGTCAACAAGGCTGCCGTCACGGCGTACAGCGCCGCTGTCGGATACTCGGTGCCGTCG
TATAGTGCTGCTATCACGGCTACCGAGAATCTGAGCACCTTTTCTGCTTGCTACTACCACAAGGTTAACAGCCAG
GTCGAGGCTGGCGCCAAGGCCATCTGGAACTCCAAGACGGGCAATGCGGTTGGTCTCGAGATCGCCGGCAAGTAC
CGTATCGATCCTGTGTCCTTTGCCAAGGTCAAGATCAACGACCGCGGCATCGCCGCCCTCGCCTACAACGTTCTT
CTCCGTGAAGGCGTCACCCTCGGTCTCGGTGGCTCCTTTGATACCCAGAAGCTCGACCAGGCGACGCACAAGCTC
GGTGCCAGCTTCACATTTGAAGGCTAG
Gene >Ophio5|6194
ATGCCTGTTCCCGCCTTCTCGGATCTTGCCAAACCGGCTAACGATGTGCGTTGCTTCATCTTTTTTTGTTCTCCC
TCTCTTGTTTCTCTTCGTGATGCTGTCATGAAGGGGAAAGGGGGAAAAAAGAAGAAGGATGACGATGAGCTGACA
AAATTCATTCGCTTCACAGCTCCTTAACAAGGATTTCTATCATCTGTCTGCTTCGACGTTCGAGTTCAAGGACAC
GGCTCCGAATGGCGTCGCCTTTAAGATCACGGGAAAGTCGAGCCACGATAAGGTCACGTCGGCGGCGGTGAGCAG
AGAGCCCCGGTTTCACGCCTTGTTGGCCTTTTTTTTTTTTTTTGGGAATGGGGAACATTTCTGACCTATATTTCT
TCCCCCGTGATAGATCGAGGGCAAATACGTCGACAAGCCTACCGGTACTTCCCCCCACAGGCATTCCCATCCTCC
TTTGCAGCCACGACTCCACGTTCTGGGTGGCAGCGTGTCTGGCATCCTCGGCCGCGGCTCCGGCTCGCCGTGCGA
GTTCGCGGCCGTCACTATATCCGGAAGAACAAGTTTGCTGATGTTTTGCCAATGCGCAGGCCTTACGCTGACGCA
GACATGGAACACGGCCAACTCGCTCGATACCAAGCTCGAGGTCAGCGACTCGTTGGCAAAGGGTCTCAAGCTCGA
GGGTCTCTTCAACTTTTTGCCCGCTACCGCTGCCCGGAATGCAAAGTTCAACCTCATGTTCAAGCAGCCCAACTT
CCACGGCCGCGCCTTCTTTGACCTGCTCAAGGGCCCTACGGCCAATGTGGACGCCGTCATCGGCCATGAGGGCTT
CTTGGCCGGCGCTAGCGCTGGTTACGACGTCAACAAGGCTGCCGTCACGGCGTACAGCGCCGCTGTCGGATACTC
GGTGCCGTCGTATAGTGCTGCTATCACGGCTACCGAGAATCTGAGCACCTTTTCTGCTTGCTACTACCACAAGGT
TAACAGCCAGGTCGAGGCTGGCGCCAAGGCCATCTGGAACTCCAAGACGGGCAATGCGGTTGGTCTCGAGATCGC
CGGCAAGTACCGTATCGATCCTGTGTCCTTTGCCAAGGTGCGACCTCCCCCTCCTCTTGGCTCCCTGCAGAAAAC
CCCCTTCTTGGGCCGGATACTGACGTAAGAGAAATGACAGGTCAAGATCAACGACCGCGGCATCGCCGCCCTCGC
CTACAACGTTCTTCTCCGTGAAGGCGTCACCCTCGGTCTCGGTGGCTCCTTTGATACCCAGAAGCTCGACCAGGC
GACGCACAAGGTATGTTTTTTTTCTTTGCCTCGCACCGAATGCATAAGGCCAGTGACTGACGGGCCCTTGTTTTT
GCGTGCAGCTCGGTGCCAGCTTCACATTTGAAGGCTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail