Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|6193
Gene name
Locationscaffold_53:27665..28623
Strand+
Gene length (bp)958
Transcript length (bp)894
Coding sequence length (bp)891
Protein length (aa) 297

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00226 DnaJ DnaJ domain 2.7E-18 54 116

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q96EY1|DNJA3_HUMAN DnaJ homolog subfamily A member 3, mitochondrial OS=Homo sapiens GN=DNAJA3 PE=1 SV=2 51 116 8.0E-13
sp|O87778|DNAJ_LACSK Chaperone protein DnaJ OS=Lactobacillus sakei GN=dnaJ PE=2 SV=1 49 116 4.0E-12
sp|B8CXL0|DNAJ_HALOH Chaperone protein DnaJ OS=Halothermothrix orenii (strain H 168 / OCM 544 / DSM 9562) GN=dnaJ PE=3 SV=1 49 116 4.0E-12
sp|Q38W94|DNAJ_LACSS Chaperone protein DnaJ OS=Lactobacillus sakei subsp. sakei (strain 23K) GN=dnaJ PE=3 SV=1 49 116 4.0E-12
sp|Q99M87|DNJA3_MOUSE DnaJ homolog subfamily A member 3, mitochondrial OS=Mus musculus GN=Dnaja3 PE=1 SV=1 51 116 5.0E-12
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q96EY1|DNJA3_HUMAN DnaJ homolog subfamily A member 3, mitochondrial OS=Homo sapiens GN=DNAJA3 PE=1 SV=2 51 116 8.0E-13
sp|O87778|DNAJ_LACSK Chaperone protein DnaJ OS=Lactobacillus sakei GN=dnaJ PE=2 SV=1 49 116 4.0E-12
sp|B8CXL0|DNAJ_HALOH Chaperone protein DnaJ OS=Halothermothrix orenii (strain H 168 / OCM 544 / DSM 9562) GN=dnaJ PE=3 SV=1 49 116 4.0E-12
sp|Q38W94|DNAJ_LACSS Chaperone protein DnaJ OS=Lactobacillus sakei subsp. sakei (strain 23K) GN=dnaJ PE=3 SV=1 49 116 4.0E-12
sp|Q99M87|DNJA3_MOUSE DnaJ homolog subfamily A member 3, mitochondrial OS=Mus musculus GN=Dnaja3 PE=1 SV=1 51 116 5.0E-12
sp|Q03QU2|DNAJ_LACBA Chaperone protein DnaJ OS=Lactobacillus brevis (strain ATCC 367 / JCM 1170) GN=dnaJ PE=3 SV=1 51 116 7.0E-12
sp|Q67S53|DNAJ_SYMTH Chaperone protein DnaJ OS=Symbiobacterium thermophilum (strain T / IAM 14863) GN=dnaJ PE=3 SV=1 51 116 2.0E-11
sp|Q24331|TID_DROVI Protein tumorous imaginal discs, mitochondrial OS=Drosophila virilis GN=l(2)tid PE=2 SV=1 52 116 4.0E-11
sp|B2GBQ6|DNAJ_LACF3 Chaperone protein DnaJ OS=Lactobacillus fermentum (strain NBRC 3956 / LMG 18251) GN=dnaJ PE=3 SV=1 51 116 6.0E-11
sp|Q03FR6|DNAJ_PEDPA Chaperone protein DnaJ OS=Pediococcus pentosaceus (strain ATCC 25745 / 183-1w) GN=dnaJ PE=3 SV=1 49 123 6.0E-11
sp|A7NS65|DNAJ_ROSCS Chaperone protein DnaJ OS=Roseiflexus castenholzii (strain DSM 13941 / HLO8) GN=dnaJ PE=3 SV=1 49 116 1.0E-10
sp|Q56237|DNAJ2_THET8 Chaperone protein DnaJ 2 OS=Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) GN=dnaJ2 PE=3 SV=2 49 116 1.0E-10
sp|A5UYW4|DNAJ_ROSS1 Chaperone protein DnaJ OS=Roseiflexus sp. (strain RS-1) GN=dnaJ PE=3 SV=1 49 116 1.0E-10
sp|Q88VM1|DNAJ_LACPL Chaperone protein DnaJ OS=Lactobacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1) GN=dnaJ PE=3 SV=1 51 116 1.0E-10
sp|Q27237|TID_DROME Protein tumorous imaginal discs, mitochondrial OS=Drosophila melanogaster GN=l(2)tid PE=1 SV=2 28 116 2.0E-10
sp|Q6L0S6|DNAJ_PICTO Chaperone protein DnaJ OS=Picrophilus torridus (strain ATCC 700027 / DSM 9790 / JCM 10055 / NBRC 100828) GN=dnaJ PE=3 SV=1 52 118 2.0E-10
sp|Q9ZFC5|DNAJ_METSS Chaperone protein DnaJ OS=Methylovorus sp. (strain SS1 / DSM 11726) GN=dnaJ PE=3 SV=1 51 116 2.0E-10
sp|B1YKT0|DNAJ_EXIS2 Chaperone protein DnaJ OS=Exiguobacterium sibiricum (strain DSM 17290 / JCM 13490 / 255-15) GN=dnaJ PE=3 SV=1 54 116 3.0E-10
sp|Q3AF07|DNAJ_CARHZ Chaperone protein DnaJ OS=Carboxydothermus hydrogenoformans (strain ATCC BAA-161 / DSM 6008 / Z-2901) GN=dnaJ PE=3 SV=1 54 116 3.0E-10
sp|Q8RB67|DNAJ_CALS4 Chaperone protein DnaJ OS=Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4) GN=dnaJ PE=3 SV=1 53 116 4.0E-10
sp|Q607A6|DNAJ_METCA Chaperone protein DnaJ OS=Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath) GN=dnaJ PE=3 SV=1 51 116 5.0E-10
sp|Q5M6D0|DNAJ_STRT2 Chaperone protein DnaJ OS=Streptococcus thermophilus (strain ATCC BAA-250 / LMG 18311) GN=dnaJ PE=3 SV=1 54 116 8.0E-10
sp|Q5M1T7|DNAJ_STRT1 Chaperone protein DnaJ OS=Streptococcus thermophilus (strain CNRZ 1066) GN=dnaJ PE=3 SV=1 54 116 8.0E-10
sp|Q8DWH2|DNAJ_STRMU Chaperone protein DnaJ OS=Streptococcus mutans serotype c (strain ATCC 700610 / UA159) GN=dnaJ PE=3 SV=1 53 116 9.0E-10
sp|Q45552|DNAJ_GEOSE Chaperone protein DnaJ OS=Geobacillus stearothermophilus GN=dnaJ PE=3 SV=1 51 116 1.0E-09
sp|Q9KWS6|DNAJ_GEOTM Chaperone protein DnaJ OS=Geobacillus thermoglucosidasius GN=dnaJ PE=3 SV=1 51 116 1.0E-09
sp|Q5KWZ8|DNAJ_GEOKA Chaperone protein DnaJ OS=Geobacillus kaustophilus (strain HTA426) GN=dnaJ PE=3 SV=1 51 116 1.0E-09
sp|A6Q486|DNAJ_NITSB Chaperone protein DnaJ OS=Nitratiruptor sp. (strain SB155-2) GN=dnaJ PE=3 SV=1 54 116 1.0E-09
sp|C5D4U0|DNAJ_GEOSW Chaperone protein DnaJ OS=Geobacillus sp. (strain WCH70) GN=dnaJ PE=3 SV=1 51 116 2.0E-09
sp|A4IR30|DNAJ_GEOTN Chaperone protein DnaJ OS=Geobacillus thermodenitrificans (strain NG80-2) GN=dnaJ PE=3 SV=1 51 116 2.0E-09
sp|A3DF24|DNAJ_CLOTH Chaperone protein DnaJ OS=Clostridium thermocellum (strain ATCC 27405 / DSM 1237 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) GN=dnaJ PE=3 SV=1 49 116 2.0E-09
sp|B9DVF2|DNAJ_STRU0 Chaperone protein DnaJ OS=Streptococcus uberis (strain ATCC BAA-854 / 0140J) GN=dnaJ PE=3 SV=1 54 116 2.0E-09
sp|Q1LJ82|DNAJ_CUPMC Chaperone protein DnaJ OS=Cupriavidus metallidurans (strain ATCC 43123 / DSM 2839 / NBRC 102507 / CH34) GN=dnaJ PE=3 SV=1 51 116 2.0E-09
sp|Q8CWT2|DNAJ_STRR6 Chaperone protein DnaJ OS=Streptococcus pneumoniae (strain ATCC BAA-255 / R6) GN=dnaJ PE=3 SV=1 54 116 2.0E-09
sp|P95830|DNAJ_STRPN Chaperone protein DnaJ OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) GN=dnaJ PE=1 SV=2 54 116 2.0E-09
sp|Q835R5|DNAJ_ENTFA Chaperone protein DnaJ OS=Enterococcus faecalis (strain ATCC 700802 / V583) GN=dnaJ PE=3 SV=1 49 116 2.0E-09
sp|Q5SLW9|DNAJ1_THET8 Chaperone protein DnaJ 1 OS=Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) GN=dnaJ1 PE=3 SV=1 53 122 2.0E-09
sp|Q5P1H7|DNAJ2_AROAE Chaperone protein DnaJ 2 OS=Aromatoleum aromaticum (strain EbN1) GN=dnaJ2 PE=3 SV=1 51 116 3.0E-09
sp|Q72GN6|DNAJ_THET2 Chaperone protein DnaJ OS=Thermus thermophilus (strain HB27 / ATCC BAA-163 / DSM 7039) GN=dnaJ PE=3 SV=1 53 122 3.0E-09
sp|B9MJZ0|DNAJ_CALBD Chaperone protein DnaJ OS=Caldicellulosiruptor bescii (strain ATCC BAA-1888 / DSM 6725 / Z-1320) GN=dnaJ PE=3 SV=1 49 116 3.0E-09
sp|Q892R1|DNAJ_CLOTE Chaperone protein DnaJ OS=Clostridium tetani (strain Massachusetts / E88) GN=dnaJ PE=3 SV=1 53 116 3.0E-09
sp|Q7NDG8|DNAJ_GLOVI Chaperone protein DnaJ OS=Gloeobacter violaceus (strain PCC 7421) GN=dnaJ PE=3 SV=1 52 116 3.0E-09
sp|C0ZB49|DNAJ_BREBN Chaperone protein DnaJ OS=Brevibacillus brevis (strain 47 / JCM 6285 / NBRC 100599) GN=dnaJ PE=3 SV=1 54 116 3.0E-09
sp|P97554|DNJB9_RAT DnaJ homolog subfamily B member 9 OS=Rattus norvegicus GN=Dnajb9 PE=2 SV=2 49 116 4.0E-09
sp|P30725|DNAJ_CLOAB Chaperone protein DnaJ OS=Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / LMG 5710 / VKM B-1787) GN=dnaJ PE=2 SV=2 51 116 4.0E-09
sp|A6LRN5|DNAJ_CLOB8 Chaperone protein DnaJ OS=Clostridium beijerinckii (strain ATCC 51743 / NCIMB 8052) GN=dnaJ PE=3 SV=1 51 116 4.0E-09
sp|Q5WHG0|DNAJ_BACSK Chaperone protein DnaJ OS=Bacillus clausii (strain KSM-K16) GN=dnaJ PE=3 SV=1 54 116 4.0E-09
sp|P25303|SCJ1_YEAST DnaJ-related protein SCJ1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SCJ1 PE=1 SV=2 52 116 4.0E-09
sp|Q9KD71|DNAJ_BACHD Chaperone protein DnaJ OS=Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125) GN=dnaJ PE=3 SV=1 54 116 4.0E-09
sp|A4XKA5|DNAJ_CALS8 Chaperone protein DnaJ OS=Caldicellulosiruptor saccharolyticus (strain ATCC 43494 / DSM 8903 / Tp8T 6331) GN=dnaJ PE=3 SV=1 49 116 5.0E-09
sp|B9E6X0|DNAJ_MACCJ Chaperone protein DnaJ OS=Macrococcus caseolyticus (strain JCSC5402) GN=dnaJ PE=3 SV=1 51 116 5.0E-09
sp|B4F2V6|DNAJ_PROMH Chaperone protein DnaJ OS=Proteus mirabilis (strain HI4320) GN=dnaJ PE=3 SV=1 51 116 6.0E-09
sp|Q1H3B9|DNAJ_METFK Chaperone protein DnaJ OS=Methylobacillus flagellatus (strain KT / ATCC 51484 / DSM 6875) GN=dnaJ PE=3 SV=1 51 116 6.0E-09
sp|B3WEQ6|DNAJ_LACCB Chaperone protein DnaJ OS=Lactobacillus casei (strain BL23) GN=dnaJ PE=3 SV=1 49 116 6.0E-09
sp|Q038N5|DNAJ_LACC3 Chaperone protein DnaJ OS=Lactobacillus casei (strain ATCC 334) GN=dnaJ PE=3 SV=1 49 116 6.0E-09
sp|O67623|DNAJ1_AQUAE Chaperone protein DnaJ 1 OS=Aquifex aeolicus (strain VF5) GN=dnaJ1 PE=3 SV=1 51 120 6.0E-09
sp|B2SXC7|DNAJ_BURPP Chaperone protein DnaJ OS=Burkholderia phytofirmans (strain DSM 17436 / PsJN) GN=dnaJ PE=3 SV=1 51 116 6.0E-09
sp|Q145F0|DNAJ_BURXL Chaperone protein DnaJ OS=Burkholderia xenovorans (strain LB400) GN=dnaJ PE=3 SV=1 51 116 7.0E-09
sp|Q8GUN6|DNJ50_ARATH Chaperone protein dnaJ 50 OS=Arabidopsis thaliana GN=C50 PE=2 SV=1 52 122 7.0E-09
sp|C3MC05|DNAJ_RHISN Chaperone protein DnaJ OS=Rhizobium sp. (strain NGR234) GN=dnaJ PE=3 SV=1 54 116 7.0E-09
sp|B9DNJ9|DNAJ_STACT Chaperone protein DnaJ OS=Staphylococcus carnosus (strain TM300) GN=dnaJ PE=3 SV=1 51 116 7.0E-09
sp|Q5R9A4|DNJB9_PONAB DnaJ homolog subfamily B member 9 OS=Pongo abelii GN=DNAJB9 PE=2 SV=1 49 116 7.0E-09
sp|P63972|DNAJ_STAAW Chaperone protein DnaJ OS=Staphylococcus aureus (strain MW2) GN=dnaJ PE=3 SV=1 51 116 8.0E-09
sp|A8Z4B8|DNAJ_STAAT Chaperone protein DnaJ OS=Staphylococcus aureus (strain USA300 / TCH1516) GN=dnaJ PE=3 SV=1 51 116 8.0E-09
sp|Q6G8Y8|DNAJ_STAAS Chaperone protein DnaJ OS=Staphylococcus aureus (strain MSSA476) GN=dnaJ PE=3 SV=1 51 116 8.0E-09
sp|P63971|DNAJ_STAAN Chaperone protein DnaJ OS=Staphylococcus aureus (strain N315) GN=dnaJ PE=1 SV=1 51 116 8.0E-09
sp|P63970|DNAJ_STAAM Chaperone protein DnaJ OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=dnaJ PE=3 SV=1 51 116 8.0E-09
sp|A6QHC2|DNAJ_STAAE Chaperone protein DnaJ OS=Staphylococcus aureus (strain Newman) GN=dnaJ PE=3 SV=1 51 116 8.0E-09
sp|Q5HFI1|DNAJ_STAAC Chaperone protein DnaJ OS=Staphylococcus aureus (strain COL) GN=dnaJ PE=3 SV=1 51 116 8.0E-09
sp|A5ITA7|DNAJ_STAA9 Chaperone protein DnaJ OS=Staphylococcus aureus (strain JH9) GN=dnaJ PE=3 SV=1 51 116 8.0E-09
sp|Q2FXZ3|DNAJ_STAA8 Chaperone protein DnaJ OS=Staphylococcus aureus (strain NCTC 8325) GN=dnaJ PE=3 SV=1 51 116 8.0E-09
sp|Q2FGE4|DNAJ_STAA3 Chaperone protein DnaJ OS=Staphylococcus aureus (strain USA300) GN=dnaJ PE=3 SV=1 51 116 8.0E-09
sp|A6U251|DNAJ_STAA2 Chaperone protein DnaJ OS=Staphylococcus aureus (strain JH1) GN=dnaJ PE=3 SV=1 51 116 8.0E-09
sp|A7X2Y0|DNAJ_STAA1 Chaperone protein DnaJ OS=Staphylococcus aureus (strain Mu3 / ATCC 700698) GN=dnaJ PE=3 SV=1 51 116 8.0E-09
sp|Q2YT48|DNAJ_STAAB Chaperone protein DnaJ OS=Staphylococcus aureus (strain bovine RF122 / ET3-1) GN=dnaJ PE=3 SV=1 51 116 8.0E-09
sp|Q9UBS3|DNJB9_HUMAN DnaJ homolog subfamily B member 9 OS=Homo sapiens GN=DNAJB9 PE=1 SV=1 49 123 8.0E-09
sp|Q8E7Q7|DNAJ_STRA3 Chaperone protein DnaJ OS=Streptococcus agalactiae serotype III (strain NEM316) GN=dnaJ PE=3 SV=1 54 116 8.0E-09
sp|Q6GGC1|DNAJ_STAAR Chaperone protein DnaJ OS=Staphylococcus aureus (strain MRSA252) GN=dnaJ PE=3 SV=1 51 116 8.0E-09
sp|Q83CJ2|CBPA_COXBU Curved DNA-binding protein OS=Coxiella burnetii (strain RSA 493 / Nine Mile phase I) GN=cbpA PE=3 SV=1 53 116 8.0E-09
sp|A9NDK6|CBPA_COXBR Curved DNA-binding protein OS=Coxiella burnetii (strain RSA 331 / Henzerling II) GN=cbpA PE=3 SV=1 53 116 8.0E-09
sp|A9KE65|CBPA_COXBN Curved DNA-binding protein OS=Coxiella burnetii (strain Dugway 5J108-111) GN=cbpA PE=3 SV=1 53 116 8.0E-09
sp|Q8E298|DNAJ_STRA5 Chaperone protein DnaJ OS=Streptococcus agalactiae serotype V (strain ATCC BAA-611 / 2603 V/R) GN=dnaJ PE=3 SV=1 54 116 8.0E-09
sp|Q3K3T1|DNAJ_STRA1 Chaperone protein DnaJ OS=Streptococcus agalactiae serotype Ia (strain ATCC 27591 / A909 / CDC SS700) GN=dnaJ PE=3 SV=1 54 116 8.0E-09
sp|A1JJD6|DNAJ_YERE8 Chaperone protein DnaJ OS=Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081) GN=dnaJ PE=3 SV=1 51 116 9.0E-09
sp|O34136|DNAJ_DEIPM Chaperone protein DnaJ OS=Deinococcus proteolyticus (strain ATCC 35074 / DSM 20540 / JCM 6276 / NBRC 101906 / NCIMB 13154 / VKM Ac-1939 / CCM 2703 / MRP) GN=dnaJ PE=3 SV=2 51 116 1.0E-08
sp|A1U613|DNAJ_MARHV Chaperone protein DnaJ OS=Marinobacter hydrocarbonoclasticus (strain ATCC 700491 / DSM 11845 / VT8) GN=dnaJ PE=3 SV=1 51 116 1.0E-08
sp|B2G6W4|DNAJ_LACRJ Chaperone protein DnaJ OS=Lactobacillus reuteri (strain JCM 1112) GN=dnaJ PE=3 SV=1 51 116 1.0E-08
sp|A5VJE8|DNAJ_LACRD Chaperone protein DnaJ OS=Lactobacillus reuteri (strain DSM 20016) GN=dnaJ PE=3 SV=1 51 116 1.0E-08
sp|B2V2I6|DNAJ_CLOBA Chaperone protein DnaJ OS=Clostridium botulinum (strain Alaska E43 / Type E3) GN=dnaJ PE=3 SV=1 51 116 1.0E-08
sp|B2TLZ8|DNAJ_CLOBB Chaperone protein DnaJ OS=Clostridium botulinum (strain Eklund 17B / Type B) GN=dnaJ PE=3 SV=1 51 116 1.0E-08
sp|Q73T77|DNAJ2_MYCPA Chaperone protein DnaJ 2 OS=Mycobacterium paratuberculosis (strain ATCC BAA-968 / K-10) GN=dnaJ2 PE=3 SV=1 53 118 1.0E-08
sp|B0BTI6|DNAJ_ACTPJ Chaperone protein DnaJ OS=Actinobacillus pleuropneumoniae serotype 3 (strain JL03) GN=dnaJ PE=3 SV=1 51 116 1.0E-08
sp|P9WNV9|DNAJ1_MYCTU Chaperone protein DnaJ 1 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=dnaJ1 PE=1 SV=1 53 118 1.0E-08
sp|P9WNV8|DNAJ1_MYCTO Chaperone protein DnaJ 1 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=dnaJ1 PE=3 SV=1 53 118 1.0E-08
sp|P0A549|DNAJ1_MYCBO Chaperone protein DnaJ 1 OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=dnaJ1 PE=3 SV=1 53 118 1.0E-08
sp|B5YYA8|DNAJ_ECO5E Chaperone protein DnaJ OS=Escherichia coli O157:H7 (strain EC4115 / EHEC) GN=dnaJ PE=3 SV=1 51 116 1.0E-08
sp|Q71ZJ8|DNAJ_LISMF Chaperone protein DnaJ OS=Listeria monocytogenes serotype 4b (strain F2365) GN=dnaJ PE=3 SV=1 51 116 1.0E-08
sp|C1KVB9|DNAJ_LISMC Chaperone protein DnaJ OS=Listeria monocytogenes serotype 4b (strain CLIP80459) GN=dnaJ PE=3 SV=1 51 116 1.0E-08
sp|A3N3J9|DNAJ_ACTP2 Chaperone protein DnaJ OS=Actinobacillus pleuropneumoniae serotype 5b (strain L20) GN=dnaJ PE=3 SV=1 51 116 1.0E-08
sp|Q6VAY5|DNAJ_PSEST Chaperone protein DnaJ OS=Pseudomonas stutzeri GN=dnaJ PE=3 SV=1 51 116 1.0E-08
sp|Q5LWJ5|DNAJ_RUEPO Chaperone protein DnaJ OS=Ruegeria pomeroyi (strain ATCC 700808 / DSM 15171 / DSS-3) GN=dnaJ PE=3 SV=1 54 116 2.0E-08
sp|Q1GKS4|DNAJ_RUEST Chaperone protein DnaJ OS=Ruegeria sp. (strain TM1040) GN=dnaJ PE=3 SV=1 54 116 2.0E-08
sp|B2JGE1|DNAJ_BURP8 Chaperone protein DnaJ OS=Burkholderia phymatum (strain DSM 17167 / STM815) GN=dnaJ PE=3 SV=1 51 116 2.0E-08
sp|P43735|DNAJ_HAEIN Chaperone protein DnaJ OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=dnaJ PE=3 SV=1 51 116 2.0E-08
sp|B8DE39|DNAJ_LISMH Chaperone protein DnaJ OS=Listeria monocytogenes serotype 4a (strain HCC23) GN=dnaJ PE=3 SV=1 51 116 2.0E-08
sp|Q92BN9|DNAJ_LISIN Chaperone protein DnaJ OS=Listeria innocua serovar 6a (strain CLIP 11262) GN=dnaJ PE=3 SV=1 51 116 2.0E-08
sp|P0DJM1|DNAJ_LISMO Chaperone protein DnaJ OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=dnaJ PE=3 SV=1 51 116 2.0E-08
sp|G2K045|DNAJ_LISM4 Chaperone protein DnaJ OS=Listeria monocytogenes serotype 1/2a (strain 10403S) GN=dnaJ PE=3 SV=1 51 116 2.0E-08
sp|B8GNX2|DNAJ_THISH Chaperone protein DnaJ OS=Thioalkalivibrio sulfidiphilus (strain HL-EbGR7) GN=dnaJ PE=3 SV=1 51 116 2.0E-08
sp|Q74H58|DNAJ_GEOSL Chaperone protein DnaJ OS=Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA) GN=dnaJ PE=3 SV=1 50 116 2.0E-08
sp|A6UEY1|DNAJ_SINMW Chaperone protein DnaJ OS=Sinorhizobium medicae (strain WSM419) GN=dnaJ PE=3 SV=1 54 116 2.0E-08
sp|Q92T07|DNAJ_RHIME Chaperone protein DnaJ OS=Rhizobium meliloti (strain 1021) GN=dnaJ PE=3 SV=1 54 116 2.0E-08
sp|Q38813|DNAJ1_ARATH Chaperone protein dnaJ 1, mitochondrial OS=Arabidopsis thaliana GN=ATJ1 PE=2 SV=2 50 116 3.0E-08
sp|P35514|DNAJ_LACLA Chaperone protein DnaJ OS=Lactococcus lactis subsp. lactis (strain IL1403) GN=dnaJ PE=3 SV=2 54 116 3.0E-08
sp|Q5NSW9|DNAJ_BURM1 Chaperone protein DnaJ OS=Burkholderia multivorans (strain ATCC 17616 / 249) GN=dnaJ PE=3 SV=1 51 116 3.0E-08
sp|P0DA71|DNAJ_STRPQ Chaperone protein DnaJ OS=Streptococcus pyogenes serotype M3 (strain SSI-1) GN=dnaJ PE=3 SV=1 54 116 3.0E-08
sp|P0DA70|DNAJ_STRP3 Chaperone protein DnaJ OS=Streptococcus pyogenes serotype M3 (strain ATCC BAA-595 / MGAS315) GN=dnaJ PE=3 SV=1 54 116 3.0E-08
sp|P0C0B6|DNAJ_STRP1 Chaperone protein DnaJ OS=Streptococcus pyogenes serotype M1 GN=dnaJ PE=3 SV=1 54 116 3.0E-08
sp|A9IGC5|DNAJ_BORPD Chaperone protein DnaJ OS=Bordetella petrii (strain ATCC BAA-461 / DSM 12804 / CCUG 43448) GN=dnaJ PE=3 SV=1 51 116 3.0E-08
sp|A5UF67|DNAJ_HAEIG Chaperone protein DnaJ OS=Haemophilus influenzae (strain PittGG) GN=dnaJ PE=3 SV=1 51 116 3.0E-08
sp|P0C0B5|DNAJ_STRPY Chaperone protein DnaJ OS=Streptococcus pyogenes GN=dnaJ PE=3 SV=1 54 116 3.0E-08
sp|Q8NZM7|DNAJ_STRP8 Chaperone protein DnaJ OS=Streptococcus pyogenes serotype M18 (strain MGAS8232) GN=dnaJ PE=3 SV=1 54 116 3.0E-08
sp|Q5XAD7|DNAJ_STRP6 Chaperone protein DnaJ OS=Streptococcus pyogenes serotype M6 (strain ATCC BAA-946 / MGAS10394) GN=dnaJ PE=3 SV=2 54 116 3.0E-08
sp|Q93Q66|DNAJ_LACLC Chaperone protein DnaJ OS=Lactococcus lactis subsp. cremoris GN=dnaJ PE=3 SV=1 54 116 3.0E-08
sp|A2RP20|DNAJ_LACLM Chaperone protein DnaJ OS=Lactococcus lactis subsp. cremoris (strain MG1363) GN=dnaJ PE=3 SV=1 54 116 3.0E-08
sp|A0Q1R3|DNAJ_CLONN Chaperone protein DnaJ OS=Clostridium novyi (strain NT) GN=dnaJ PE=3 SV=1 51 116 4.0E-08
sp|Q02VR5|DNAJ_LACLS Chaperone protein DnaJ OS=Lactococcus lactis subsp. cremoris (strain SK11) GN=dnaJ PE=3 SV=1 54 116 4.0E-08
sp|A6WX07|DNAJ_OCHA4 Chaperone protein DnaJ OS=Ochrobactrum anthropi (strain ATCC 49188 / DSM 6882 / NCTC 12168) GN=dnaJ PE=3 SV=1 54 116 4.0E-08
sp|Q93R26|DNAJ_TETHA Chaperone protein DnaJ OS=Tetragenococcus halophilus GN=dnaJ PE=3 SV=1 49 116 4.0E-08
sp|Q2NVZ0|DNAJ_SODGM Chaperone protein DnaJ OS=Sodalis glossinidius (strain morsitans) GN=dnaJ PE=3 SV=1 51 116 4.0E-08
sp|A7HZ38|DNAJ_PARL1 Chaperone protein DnaJ OS=Parvibaculum lavamentivorans (strain DS-1 / DSM 13023 / NCIMB 13966) GN=dnaJ PE=3 SV=1 54 116 4.0E-08
sp|Q5P9E0|DNAJ_ANAMM Chaperone protein DnaJ OS=Anaplasma marginale (strain St. Maries) GN=dnaJ PE=3 SV=1 51 116 4.0E-08
sp|B9KH92|DNAJ_ANAMF Chaperone protein DnaJ OS=Anaplasma marginale (strain Florida) GN=dnaJ PE=3 SV=1 51 116 4.0E-08
sp|P26508|NOLC_RHIFR Protein NolC OS=Rhizobium fredii GN=nolC PE=3 SV=1 53 116 5.0E-08
sp|A1KR91|DNAJ_NEIMF Chaperone protein DnaJ OS=Neisseria meningitidis serogroup C / serotype 2a (strain ATCC 700532 / DSM 15464 / FAM18) GN=dnaJ PE=3 SV=1 53 116 5.0E-08
sp|P63969|DNAJ_NEIMB Chaperone protein DnaJ OS=Neisseria meningitidis serogroup B (strain MC58) GN=dnaJ PE=3 SV=1 53 116 5.0E-08
sp|P63968|DNAJ_NEIMA Chaperone protein DnaJ OS=Neisseria meningitidis serogroup A / serotype 4A (strain Z2491) GN=dnaJ PE=3 SV=1 53 116 5.0E-08
sp|A9LZV9|DNAJ_NEIM0 Chaperone protein DnaJ OS=Neisseria meningitidis serogroup C (strain 053442) GN=dnaJ PE=3 SV=1 53 116 5.0E-08
sp|Q8CP18|DNAJ_STAES Chaperone protein DnaJ OS=Staphylococcus epidermidis (strain ATCC 12228) GN=dnaJ PE=3 SV=1 51 116 5.0E-08
sp|Q82BY4|DNAJ2_STRAW Chaperone protein DnaJ 2 OS=Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680) GN=dnaJ2 PE=3 SV=1 52 116 5.0E-08
sp|Q9RDD7|DNAJ2_STRCO Chaperone protein DnaJ 2 OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=dnaJ2 PE=3 SV=1 52 116 5.0E-08
sp|Q9UXR9|DNAJ_METTE Chaperone protein DnaJ OS=Methanosarcina thermophila GN=dnaJ PE=3 SV=1 49 116 5.0E-08
sp|Q4QJW5|DNAJ_HAEI8 Chaperone protein DnaJ OS=Haemophilus influenzae (strain 86-028NP) GN=dnaJ PE=3 SV=1 51 116 6.0E-08
sp|O52164|DNAJ2_STRAL Chaperone protein DnaJ 2 OS=Streptomyces albus G GN=dnaJ2 PE=3 SV=1 52 116 6.0E-08
sp|Q9QYI6|DNJB9_MOUSE DnaJ homolog subfamily B member 9 OS=Mus musculus GN=Dnajb9 PE=1 SV=2 49 116 6.0E-08
sp|C1DD87|DNAJ_LARHH Chaperone protein DnaJ OS=Laribacter hongkongensis (strain HLHK9) GN=dnaJ PE=3 SV=1 53 116 6.0E-08
sp|B0S1F7|DNAJ_FINM2 Chaperone protein DnaJ OS=Finegoldia magna (strain ATCC 29328) GN=dnaJ PE=3 SV=1 53 116 6.0E-08
sp|Q3Z600|DNAJ_SHISS Chaperone protein DnaJ OS=Shigella sonnei (strain Ss046) GN=dnaJ PE=3 SV=1 51 116 6.0E-08
sp|B7LVP7|DNAJ_ESCF3 Chaperone protein DnaJ OS=Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CDC 0568-73) GN=dnaJ PE=3 SV=1 51 116 6.0E-08
sp|Q1RGI7|DNAJ_ECOUT Chaperone protein DnaJ OS=Escherichia coli (strain UTI89 / UPEC) GN=dnaJ PE=3 SV=1 51 116 6.0E-08
sp|B1LFU5|DNAJ_ECOSM Chaperone protein DnaJ OS=Escherichia coli (strain SMS-3-5 / SECEC) GN=dnaJ PE=3 SV=1 51 116 6.0E-08
sp|B6HZ11|DNAJ_ECOSE Chaperone protein DnaJ OS=Escherichia coli (strain SE11) GN=dnaJ PE=3 SV=1 51 116 6.0E-08
sp|B7N7N9|DNAJ_ECOLU Chaperone protein DnaJ OS=Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC) GN=dnaJ PE=3 SV=1 51 116 6.0E-08
sp|B1IRF9|DNAJ_ECOLC Chaperone protein DnaJ OS=Escherichia coli (strain ATCC 8739 / DSM 1576 / Crooks) GN=dnaJ PE=3 SV=1 51 116 6.0E-08
sp|Q8FLC5|DNAJ_ECOL6 Chaperone protein DnaJ OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=dnaJ PE=3 SV=3 51 116 6.0E-08
sp|A7ZVV8|DNAJ_ECOHS Chaperone protein DnaJ OS=Escherichia coli O9:H4 (strain HS) GN=dnaJ PE=3 SV=1 51 116 6.0E-08
sp|B7M0B1|DNAJ_ECO8A Chaperone protein DnaJ OS=Escherichia coli O8 (strain IAI1) GN=dnaJ PE=3 SV=1 51 116 6.0E-08
sp|B7MNM2|DNAJ_ECO81 Chaperone protein DnaJ OS=Escherichia coli O81 (strain ED1a) GN=dnaJ PE=3 SV=1 51 116 6.0E-08
sp|B7NHB7|DNAJ_ECO7I Chaperone protein DnaJ OS=Escherichia coli O7:K1 (strain IAI39 / ExPEC) GN=dnaJ PE=3 SV=1 51 116 6.0E-08
sp|Q8XA65|DNAJ_ECO57 Chaperone protein DnaJ OS=Escherichia coli O157:H7 GN=dnaJ PE=3 SV=3 51 116 6.0E-08
sp|B7L4D9|DNAJ_ECO55 Chaperone protein DnaJ OS=Escherichia coli (strain 55989 / EAEC) GN=dnaJ PE=3 SV=1 51 116 6.0E-08
sp|B7MAD6|DNAJ_ECO45 Chaperone protein DnaJ OS=Escherichia coli O45:K1 (strain S88 / ExPEC) GN=dnaJ PE=3 SV=1 51 116 6.0E-08
sp|B7UI60|DNAJ_ECO27 Chaperone protein DnaJ OS=Escherichia coli O127:H6 (strain E2348/69 / EPEC) GN=dnaJ PE=3 SV=1 51 116 6.0E-08
sp|A7ZHA5|DNAJ_ECO24 Chaperone protein DnaJ OS=Escherichia coli O139:H28 (strain E24377A / ETEC) GN=dnaJ PE=3 SV=1 51 116 6.0E-08
sp|Q326K6|DNAJ_SHIBS Chaperone protein DnaJ OS=Shigella boydii serotype 4 (strain Sb227) GN=dnaJ PE=3 SV=1 51 116 6.0E-08
sp|B2U233|DNAJ_SHIB3 Chaperone protein DnaJ OS=Shigella boydii serotype 18 (strain CDC 3083-94 / BS512) GN=dnaJ PE=3 SV=1 51 116 6.0E-08
sp|Q32KA4|DNAJ_SHIDS Chaperone protein DnaJ OS=Shigella dysenteriae serotype 1 (strain Sd197) GN=dnaJ PE=3 SV=1 51 116 6.0E-08
sp|Q5F5M1|DNAJ_NEIG1 Chaperone protein DnaJ OS=Neisseria gonorrhoeae (strain ATCC 700825 / FA 1090) GN=dnaJ PE=3 SV=1 53 116 6.0E-08
sp|Q49Y21|DNAJ_STAS1 Chaperone protein DnaJ OS=Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229) GN=dnaJ PE=3 SV=1 51 116 6.0E-08
sp|Q8MPX3|DNJ20_CAEEL DnaJ homolog dnj-20 OS=Caenorhabditis elegans GN=dnj-20 PE=3 SV=2 28 116 7.0E-08
sp|B8DQW8|DNAJ_DESVM Chaperone protein DnaJ OS=Desulfovibrio vulgaris (strain Miyazaki F / DSM 19637) GN=dnaJ PE=3 SV=1 54 116 8.0E-08
sp|A6T4F5|DNAJ_KLEP7 Chaperone protein DnaJ OS=Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578) GN=dnaJ PE=3 SV=1 51 116 8.0E-08
sp|Q9ZSY2|DNJ15_ARATH Chaperone protein dnaJ 15 OS=Arabidopsis thaliana GN=ATJ15 PE=1 SV=1 56 116 8.0E-08
sp|P92029|DNJ60_DROME DnaJ-like protein 60 OS=Drosophila melanogaster GN=DnaJ-60 PE=2 SV=1 56 119 8.0E-08
sp|B5Y241|DNAJ_KLEP3 Chaperone protein DnaJ OS=Klebsiella pneumoniae (strain 342) GN=dnaJ PE=3 SV=1 51 116 8.0E-08
sp|Q7MN84|DNAJ_VIBVY Chaperone protein DnaJ OS=Vibrio vulnificus (strain YJ016) GN=dnaJ PE=3 SV=2 54 116 9.0E-08
sp|Q8DF67|DNAJ_VIBVU Chaperone protein DnaJ OS=Vibrio vulnificus (strain CMCP6) GN=dnaJ PE=3 SV=1 54 116 9.0E-08
sp|Q7N8Y3|DNAJ_PHOLL Chaperone protein DnaJ OS=Photorhabdus luminescens subsp. laumondii (strain TT01) GN=dnaJ PE=3 SV=1 51 116 9.0E-08
sp|Q05646|DNAJ_ERYRH Chaperone protein DnaJ OS=Erysipelothrix rhusiopathiae GN=dnaJ PE=2 SV=1 49 116 9.0E-08
sp|Q11KJ5|DNAJ_CHESB Chaperone protein DnaJ OS=Chelativorans sp. (strain BNC1) GN=dnaJ PE=3 SV=1 54 116 1.0E-07
sp|Q9ZDY0|DNAJ_RICPR Chaperone protein DnaJ OS=Rickettsia prowazekii (strain Madrid E) GN=dnaJ PE=3 SV=1 52 116 1.0E-07
sp|A4JBS2|DNAJ_BURVG Chaperone protein DnaJ OS=Burkholderia vietnamiensis (strain G4 / LMG 22486) GN=dnaJ PE=3 SV=1 51 116 1.0E-07
sp|Q39JC7|DNAJ_BURL3 Chaperone protein DnaJ OS=Burkholderia lata (strain ATCC 17760 / LMG 22485 / NCIMB 9086 / R18194 / 383) GN=dnaJ PE=3 SV=1 51 116 1.0E-07
sp|P45555|DNAJ_STAAU Chaperone protein DnaJ OS=Staphylococcus aureus GN=dnaJ PE=3 SV=1 51 116 1.0E-07
sp|O27352|DNAJ_METTH Chaperone protein DnaJ OS=Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H) GN=dnaJ PE=3 SV=1 51 116 1.0E-07
sp|B8F7S3|DNAJ_HAEPS Chaperone protein DnaJ OS=Haemophilus parasuis serovar 5 (strain SH0165) GN=dnaJ PE=3 SV=1 51 116 1.0E-07
sp|C5B7L8|DNAJ_EDWI9 Chaperone protein DnaJ OS=Edwardsiella ictaluri (strain 93-146) GN=dnaJ PE=3 SV=1 51 116 1.0E-07
sp|A0AIS3|DNAJ_LISW6 Chaperone protein DnaJ OS=Listeria welshimeri serovar 6b (strain ATCC 35897 / DSM 20650 / SLCC5334) GN=dnaJ PE=3 SV=1 51 116 1.0E-07
sp|P50025|DNAJ_LEGPN Chaperone protein DnaJ OS=Legionella pneumophila GN=dnaJ PE=3 SV=1 54 116 1.0E-07
sp|Q5ZTY4|DNAJ_LEGPH Chaperone protein DnaJ OS=Legionella pneumophila subsp. pneumophila (strain Philadelphia 1 / ATCC 33152 / DSM 7513) GN=dnaJ PE=3 SV=1 54 116 1.0E-07
sp|A5IDK7|DNAJ_LEGPC Chaperone protein DnaJ OS=Legionella pneumophila (strain Corby) GN=dnaJ PE=3 SV=1 54 116 1.0E-07
sp|Q5X3M8|DNAJ_LEGPA Chaperone protein DnaJ OS=Legionella pneumophila (strain Paris) GN=dnaJ PE=3 SV=1 54 116 1.0E-07
sp|Q5WV16|DNAJ_LEGPL Chaperone protein DnaJ OS=Legionella pneumophila (strain Lens) GN=dnaJ PE=3 SV=1 54 116 1.0E-07
sp|P40170|DNAJ1_STRCO Chaperone protein DnaJ 1 OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=dnaJ1 PE=3 SV=2 53 116 1.0E-07
sp|Q83NI2|DNAJ_TROW8 Chaperone protein DnaJ OS=Tropheryma whipplei (strain TW08/27) GN=dnaJ PE=3 SV=1 53 125 1.0E-07
sp|Q5HNW7|DNAJ_STAEQ Chaperone protein DnaJ OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=dnaJ PE=3 SV=1 51 116 1.0E-07
sp|Q6RSN5|DNAJ_RHIRD Chaperone protein DnaJ OS=Rhizobium radiobacter GN=dnaJ PE=1 SV=1 51 116 1.0E-07
sp|O87385|DNAJ_VIBHA Chaperone protein DnaJ OS=Vibrio harveyi GN=dnaJ PE=3 SV=1 54 116 1.0E-07
sp|P50027|DNAJH_SYNY3 DnAJ-like protein slr0093 OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=slr0093 PE=3 SV=1 53 116 1.0E-07
sp|B8I304|DNAJ_CLOCE Chaperone protein DnaJ OS=Clostridium cellulolyticum (strain ATCC 35319 / DSM 5812 / JCM 6584 / H10) GN=dnaJ PE=3 SV=1 49 116 1.0E-07
sp|A8LQ63|DNAJ_DINSH Chaperone protein DnaJ OS=Dinoroseobacter shibae (strain DSM 16493 / NCIMB 14021 / DFL 12) GN=dnaJ PE=3 SV=1 51 116 1.0E-07
sp|Q65H55|DNAJ_BACLD Chaperone protein DnaJ OS=Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / NBRC 12200 / NCIMB 9375 / NRRL NRS-1264 / Gibson 46) GN=dnaJ PE=3 SV=1 54 116 1.0E-07
sp|O06431|DNAJ_NITEU Chaperone protein DnaJ OS=Nitrosomonas europaea (strain ATCC 19718 / NBRC 14298) GN=dnaJ PE=3 SV=2 54 116 1.0E-07
sp|A6QBG7|DNAJ_SULNB Chaperone protein DnaJ OS=Sulfurovum sp. (strain NBC37-1) GN=dnaJ PE=3 SV=1 51 116 1.0E-07
sp|A7MWW1|DNAJ_VIBCB Chaperone protein DnaJ OS=Vibrio campbellii (strain ATCC BAA-1116 / BB120) GN=dnaJ PE=3 SV=1 54 116 1.0E-07
sp|Q9NNZ3|DNJC4_HUMAN DnaJ homolog subfamily C member 4 OS=Homo sapiens GN=DNAJC4 PE=1 SV=1 43 124 1.0E-07
sp|Q8TA83|DNJ10_CAEEL DnaJ homolog dnj-10 OS=Caenorhabditis elegans GN=dnj-10 PE=3 SV=1 51 116 2.0E-07
sp|B3R6G6|DNAJ_CUPTR Chaperone protein DnaJ OS=Cupriavidus taiwanensis (strain R1 / LMG 19424) GN=dnaJ PE=3 SV=1 51 116 2.0E-07
sp|Q8CXD3|DNAJ_OCEIH Chaperone protein DnaJ OS=Oceanobacillus iheyensis (strain DSM 14371 / JCM 11309 / KCTC 3954 / HTE831) GN=dnaJ PE=3 SV=1 54 116 2.0E-07
sp|B7IFE0|DNAJ_THEAB Chaperone protein DnaJ OS=Thermosipho africanus (strain TCF52B) GN=dnaJ PE=3 SV=1 51 116 2.0E-07
sp|B9JGW2|DNAJ_AGRRK Chaperone protein DnaJ OS=Agrobacterium radiobacter (strain K84 / ATCC BAA-868) GN=dnaJ PE=3 SV=1 51 116 2.0E-07
sp|Q0T8H5|DNAJ_SHIF8 Chaperone protein DnaJ OS=Shigella flexneri serotype 5b (strain 8401) GN=dnaJ PE=3 SV=1 51 116 2.0E-07
sp|Q5QXL2|DNAJ_IDILO Chaperone protein DnaJ OS=Idiomarina loihiensis (strain ATCC BAA-735 / DSM 15497 / L2-TR) GN=dnaJ PE=3 SV=1 51 116 2.0E-07
sp|B0TQC1|DNAJ_SHEHH Chaperone protein DnaJ OS=Shewanella halifaxensis (strain HAW-EB4) GN=dnaJ PE=3 SV=1 54 116 2.0E-07
sp|Q1MN12|DNAJ_RHIL3 Chaperone protein DnaJ OS=Rhizobium leguminosarum bv. viciae (strain 3841) GN=dnaJ PE=3 SV=1 51 116 2.0E-07
sp|P08622|DNAJ_ECOLI Chaperone protein DnaJ OS=Escherichia coli (strain K12) GN=dnaJ PE=1 SV=3 51 116 2.0E-07
sp|B1XBE0|DNAJ_ECODH Chaperone protein DnaJ OS=Escherichia coli (strain K12 / DH10B) GN=dnaJ PE=3 SV=1 51 116 2.0E-07
sp|B3PXH2|DNAJ_RHIE6 Chaperone protein DnaJ OS=Rhizobium etli (strain CIAT 652) GN=dnaJ PE=3 SV=1 51 116 2.0E-07
sp|P48208|DNAJ_HAEDU Chaperone protein DnaJ OS=Haemophilus ducreyi (strain 35000HP / ATCC 700724) GN=dnaJ PE=3 SV=1 51 116 2.0E-07
sp|Q02605|DNAJ1_MYCLE Chaperone protein DnaJ 1 OS=Mycobacterium leprae (strain TN) GN=dnaJ1 PE=3 SV=2 53 118 2.0E-07
sp|Q7UDU1|DNAJ_SHIFL Chaperone protein DnaJ OS=Shigella flexneri GN=dnaJ PE=3 SV=3 51 116 2.0E-07
sp|Q6KHF9|DNAJ_MYCMO Chaperone protein DnaJ OS=Mycoplasma mobile (strain ATCC 43663 / 163K / NCTC 11711) GN=dnaJ PE=3 SV=1 53 116 2.0E-07
sp|C4L424|DNAJ_EXISA Chaperone protein DnaJ OS=Exiguobacterium sp. (strain ATCC BAA-1283 / AT1b) GN=dnaJ PE=3 SV=1 51 116 2.0E-07
sp|B6IZJ1|DNAJ_COXB2 Chaperone protein DnaJ OS=Coxiella burnetii (strain CbuG_Q212) GN=dnaJ PE=3 SV=1 51 116 2.0E-07
sp|B1ZUS0|DNAJ_OPITP Chaperone protein DnaJ OS=Opitutus terrae (strain DSM 11246 / PB90-1) GN=dnaJ PE=3 SV=1 51 116 2.0E-07
sp|Q73IV4|DNAJ_WOLPM Chaperone protein DnaJ OS=Wolbachia pipientis wMel GN=dnaJ PE=3 SV=1 51 116 2.0E-07
sp|B0CAZ0|DNAJ_ACAM1 Chaperone protein DnaJ OS=Acaryochloris marina (strain MBIC 11017) GN=dnaJ PE=3 SV=1 52 116 2.0E-07
sp|O33529|DNAJ_RHILE Chaperone protein DnaJ (Fragment) OS=Rhizobium leguminosarum GN=dnaJ PE=3 SV=1 51 116 2.0E-07
sp|A9KG87|DNAJ_COXBN Chaperone protein DnaJ OS=Coxiella burnetii (strain Dugway 5J108-111) GN=dnaJ PE=3 SV=1 51 116 2.0E-07
sp|B6J7U6|DNAJ_COXB1 Chaperone protein DnaJ OS=Coxiella burnetii (strain CbuK_Q154) GN=dnaJ PE=3 SV=1 51 116 2.0E-07
sp|Q9CMS2|DNAJ_PASMU Chaperone protein DnaJ OS=Pasteurella multocida (strain Pm70) GN=dnaJ PE=3 SV=1 51 116 3.0E-07
sp|Q8DKR7|DNAJ_THEEB Chaperone protein DnaJ OS=Thermosynechococcus elongatus (strain BP-1) GN=dnaJ PE=3 SV=2 52 116 3.0E-07
sp|C4K3I5|DNAJ_HAMD5 Chaperone protein DnaJ OS=Hamiltonella defensa subsp. Acyrthosiphon pisum (strain 5AT) GN=dnaJ PE=3 SV=1 51 116 3.0E-07
sp|Q8L397|DNAJ_ACHLA Chaperone protein DnaJ OS=Acholeplasma laidlawii GN=dnaJ PE=3 SV=1 51 116 3.0E-07
sp|Q8L3D3|DNAJ_COLMA Chaperone protein DnaJ OS=Colwellia maris GN=dnaJ PE=3 SV=2 54 116 3.0E-07
sp|B1HUD0|DNAJ_LYSSC Chaperone protein DnaJ OS=Lysinibacillus sphaericus (strain C3-41) GN=dnaJ PE=3 SV=1 54 116 3.0E-07
sp|Q9HJ83|DNAJ_THEAC Chaperone protein DnaJ OS=Thermoplasma acidophilum (strain ATCC 25905 / DSM 1728 / JCM 9062 / NBRC 15155 / AMRC-C165) GN=dnaJ PE=3 SV=1 52 118 3.0E-07
sp|P50018|DNAJ_AGRFC Chaperone protein DnaJ OS=Agrobacterium fabrum (strain C58 / ATCC 33970) GN=dnaJ PE=2 SV=2 51 116 3.0E-07
sp|Q3YT99|DNAJ_EHRCJ Chaperone protein DnaJ OS=Ehrlichia canis (strain Jake) GN=dnaJ PE=3 SV=1 54 116 3.0E-07
sp|C3K274|DNAJ_PSEFS Chaperone protein DnaJ OS=Pseudomonas fluorescens (strain SBW25) GN=dnaJ PE=3 SV=1 51 116 3.0E-07
sp|Q89AU7|DNAJ_BUCBP Chaperone protein DnaJ OS=Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp) GN=dnaJ PE=3 SV=1 50 116 3.0E-07
sp|Q49762|DNAJ2_MYCLE Chaperone protein DnaJ 2 OS=Mycobacterium leprae (strain TN) GN=dnaJ2 PE=3 SV=1 52 131 3.0E-07
sp|A6T225|DNAJ_JANMA Chaperone protein DnaJ OS=Janthinobacterium sp. (strain Marseille) GN=dnaJ PE=3 SV=1 51 116 3.0E-07
sp|Q9LCQ4|DNAJ_BRECH Chaperone protein DnaJ OS=Brevibacillus choshinensis GN=dnaJ PE=3 SV=1 54 116 3.0E-07
sp|Q28VY4|DNAJ_JANSC Chaperone protein DnaJ OS=Jannaschia sp. (strain CCS1) GN=dnaJ PE=3 SV=1 51 116 3.0E-07
sp|Q5N0G1|DNAJ_SYNP6 Chaperone protein DnaJ OS=Synechococcus sp. (strain ATCC 27144 / PCC 6301 / SAUG 1402/1) GN=dnaJ PE=3 SV=1 52 116 3.0E-07
sp|B5YAR4|DNAJ_DICT6 Chaperone protein DnaJ OS=Dictyoglomus thermophilum (strain ATCC 35947 / DSM 3960 / H-6-12) GN=dnaJ PE=3 SV=1 53 116 3.0E-07
sp|Q8FXX1|DNAJ_BRUSU Chaperone protein DnaJ OS=Brucella suis biovar 1 (strain 1330) GN=dnaJ PE=3 SV=1 54 116 3.0E-07
sp|B0CJX5|DNAJ_BRUSI Chaperone protein DnaJ OS=Brucella suis (strain ATCC 23445 / NCTC 10510) GN=dnaJ PE=3 SV=1 54 116 3.0E-07
sp|Q8YE77|DNAJ_BRUME Chaperone protein DnaJ OS=Brucella melitensis biotype 1 (strain 16M / ATCC 23456 / NCTC 10094) GN=dnaJ PE=3 SV=1 54 116 3.0E-07
sp|C0RG11|DNAJ_BRUMB Chaperone protein DnaJ OS=Brucella melitensis biotype 2 (strain ATCC 23457) GN=dnaJ PE=3 SV=1 54 116 3.0E-07
sp|A9M9V9|DNAJ_BRUC2 Chaperone protein DnaJ OS=Brucella canis (strain ATCC 23365 / NCTC 10854) GN=dnaJ PE=3 SV=1 54 116 3.0E-07
sp|B1LZ52|DNAJ_METRJ Chaperone protein DnaJ OS=Methylobacterium radiotolerans (strain ATCC 27329 / DSM 1819 / JCM 2831) GN=dnaJ PE=3 SV=1 54 116 3.0E-07
sp|Q0A7E4|DNAJ_ALKEH Chaperone protein DnaJ OS=Alkalilimnicola ehrlichii (strain ATCC BAA-1101 / DSM 17681 / MLHE-1) GN=dnaJ PE=3 SV=1 54 116 3.0E-07
sp|Q05980|DNAJ_BRUO2 Chaperone protein DnaJ OS=Brucella ovis (strain ATCC 25840 / 63/290 / NCTC 10512) GN=dnaJ PE=2 SV=2 54 116 4.0E-07
sp|A4W6D6|DNAJ_ENT38 Chaperone protein DnaJ OS=Enterobacter sp. (strain 638) GN=dnaJ PE=3 SV=1 51 116 4.0E-07
sp|Q57AD6|DNAJ_BRUAB Chaperone protein DnaJ OS=Brucella abortus biovar 1 (strain 9-941) GN=dnaJ PE=3 SV=1 54 116 4.0E-07
sp|Q2YQV1|DNAJ_BRUA2 Chaperone protein DnaJ OS=Brucella abortus (strain 2308) GN=dnaJ PE=3 SV=1 54 116 4.0E-07
sp|B2S9C2|DNAJ_BRUA1 Chaperone protein DnaJ OS=Brucella abortus (strain S19) GN=dnaJ PE=3 SV=1 54 116 4.0E-07
sp|O59731|YHXB_SCHPO Uncharacterized J domain-containing protein C3E7.11c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC3E7.11c PE=3 SV=1 54 116 4.0E-07
sp|A7Z6W0|DNAJ_BACMF Chaperone protein DnaJ OS=Bacillus methylotrophicus (strain DSM 23117 / BGSC 10A6 / FZB42) GN=dnaJ PE=3 SV=1 54 116 4.0E-07
sp|Q049W7|DNAJ_LACDB Chaperone protein DnaJ OS=Lactobacillus delbrueckii subsp. bulgaricus (strain ATCC BAA-365) GN=dnaJ PE=3 SV=1 49 116 4.0E-07
sp|Q1G9R3|DNAJ_LACDA Chaperone protein DnaJ OS=Lactobacillus delbrueckii subsp. bulgaricus (strain ATCC 11842 / DSM 20081 / JCM 1002 / NBRC 13953 / NCIMB 11778) GN=dnaJ PE=3 SV=1 49 116 4.0E-07
sp|B5BLH9|DNAJ_SALPK Chaperone protein DnaJ OS=Salmonella paratyphi A (strain AKU_12601) GN=dnaJ PE=3 SV=1 51 116 4.0E-07
sp|Q5PDJ4|DNAJ_SALPA Chaperone protein DnaJ OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=dnaJ PE=3 SV=3 51 116 4.0E-07
sp|P0A1G7|DNAJ_SALTY Chaperone protein DnaJ OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=dnaJ PE=3 SV=2 51 116 4.0E-07
sp|P0A1G8|DNAJ_SALTI Chaperone protein DnaJ OS=Salmonella typhi GN=dnaJ PE=3 SV=2 51 116 4.0E-07
sp|B4TVZ6|DNAJ_SALSV Chaperone protein DnaJ OS=Salmonella schwarzengrund (strain CVM19633) GN=dnaJ PE=3 SV=1 51 116 4.0E-07
sp|C0Q4F4|DNAJ_SALPC Chaperone protein DnaJ OS=Salmonella paratyphi C (strain RKS4594) GN=dnaJ PE=3 SV=1 51 116 4.0E-07
sp|A9MXI3|DNAJ_SALPB Chaperone protein DnaJ OS=Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7) GN=dnaJ PE=3 SV=1 51 116 4.0E-07
sp|B4T6D7|DNAJ_SALNS Chaperone protein DnaJ OS=Salmonella newport (strain SL254) GN=dnaJ PE=3 SV=1 51 116 4.0E-07
sp|B4TIB5|DNAJ_SALHS Chaperone protein DnaJ OS=Salmonella heidelberg (strain SL476) GN=dnaJ PE=3 SV=1 51 116 4.0E-07
sp|B5RF09|DNAJ_SALG2 Chaperone protein DnaJ OS=Salmonella gallinarum (strain 287/91 / NCTC 13346) GN=dnaJ PE=3 SV=1 51 116 4.0E-07
sp|B5R5I3|DNAJ_SALEP Chaperone protein DnaJ OS=Salmonella enteritidis PT4 (strain P125109) GN=dnaJ PE=3 SV=1 51 116 4.0E-07
sp|B5FHA7|DNAJ_SALDC Chaperone protein DnaJ OS=Salmonella dublin (strain CT_02021853) GN=dnaJ PE=3 SV=1 51 116 4.0E-07
sp|Q57TP2|DNAJ_SALCH Chaperone protein DnaJ OS=Salmonella choleraesuis (strain SC-B67) GN=dnaJ PE=3 SV=3 51 116 4.0E-07
sp|B5F6Y9|DNAJ_SALA4 Chaperone protein DnaJ OS=Salmonella agona (strain SL483) GN=dnaJ PE=3 SV=1 51 116 4.0E-07
sp|Q97BG9|DNAJ_THEVO Chaperone protein DnaJ OS=Thermoplasma volcanium (strain ATCC 51530 / DSM 4299 / JCM 9571 / NBRC 15438 / GSS1) GN=dnaJ PE=3 SV=1 52 118 4.0E-07
sp|A4G8D1|DNAJ_HERAR Chaperone protein DnaJ OS=Herminiimonas arsenicoxydans GN=dnaJ PE=3 SV=1 51 116 4.0E-07
sp|Q09912|PSI1_SCHPO Protein psi1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=psi1 PE=2 SV=2 49 116 4.0E-07
sp|Q84BU3|DNAJ_LACAC Chaperone protein DnaJ OS=Lactobacillus acidophilus (strain ATCC 700396 / NCK56 / N2 / NCFM) GN=dnaJ PE=3 SV=1 51 116 4.0E-07
sp|Q75VW3|DNAJ_HYDTT Chaperone protein DnaJ OS=Hydrogenobacter thermophilus (strain DSM 6534 / IAM 12695 / TK-6) GN=dnaJ PE=3 SV=1 53 120 4.0E-07
sp|B7KSZ5|DNAJ_METC4 Chaperone protein DnaJ OS=Methylobacterium extorquens (strain CM4 / NCIMB 13688) GN=dnaJ PE=3 SV=1 54 116 4.0E-07
sp|Q5F1R6|DJC21_HUMAN DnaJ homolog subfamily C member 21 OS=Homo sapiens GN=DNAJC21 PE=1 SV=2 56 117 4.0E-07
sp|A9W6R8|DNAJ_METEP Chaperone protein DnaJ OS=Methylobacterium extorquens (strain PA1) GN=dnaJ PE=3 SV=1 54 116 4.0E-07
sp|A1WX30|DNAJ_HALHL Chaperone protein DnaJ OS=Halorhodospira halophila (strain DSM 244 / SL1) GN=dnaJ PE=3 SV=1 51 116 4.0E-07
sp|B1ZGR2|DNAJ_METPB Chaperone protein DnaJ OS=Methylobacterium populi (strain ATCC BAA-705 / NCIMB 13946 / BJ001) GN=dnaJ PE=3 SV=1 54 116 4.0E-07
sp|A5WBF8|DNAJ_PSYWF Chaperone protein DnaJ OS=Psychrobacter sp. (strain PRwf-1) GN=dnaJ PE=3 SV=1 54 116 4.0E-07
sp|Q2JW78|DNAJ_SYNJA Chaperone protein DnaJ OS=Synechococcus sp. (strain JA-3-3Ab) GN=dnaJ PE=3 SV=1 52 116 5.0E-07
sp|Q0II91|DJC21_BOVIN DnaJ homolog subfamily C member 21 OS=Bos taurus GN=DNAJC21 PE=2 SV=2 56 117 5.0E-07
sp|C4Z1J3|DNAJ_EUBE2 Chaperone protein DnaJ OS=Eubacterium eligens (strain ATCC 27750 / VPI C15-48) GN=dnaJ PE=3 SV=1 49 116 5.0E-07
sp|Q83MZ4|DNAJ_TROWT Chaperone protein DnaJ OS=Tropheryma whipplei (strain Twist) GN=dnaJ PE=3 SV=1 53 125 5.0E-07
sp|P17631|DNAJ_BACSU Chaperone protein DnaJ OS=Bacillus subtilis (strain 168) GN=dnaJ PE=2 SV=3 54 116 5.0E-07
sp|C4L8Y4|DNAJ_TOLAT Chaperone protein DnaJ OS=Tolumonas auensis (strain DSM 9187 / TA4) GN=dnaJ PE=3 SV=1 51 116 5.0E-07
sp|C4ZPU1|DNAJ_ECOBW Chaperone protein DnaJ OS=Escherichia coli (strain K12 / MC4100 / BW2952) GN=dnaJ PE=3 SV=1 51 116 5.0E-07
sp|P56101|DNJC5_TORCA DnaJ homolog subfamily C member 5 OS=Torpedo californica GN=dnajc5 PE=1 SV=1 55 116 5.0E-07
sp|Q7NXI1|DNAJ_CHRVO Chaperone protein DnaJ OS=Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / NBRC 12614 / NCIMB 9131 / NCTC 9757) GN=dnaJ PE=3 SV=1 54 116 5.0E-07
sp|Q8TQR1|DNAJ_METAC Chaperone protein DnaJ OS=Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A) GN=dnaJ PE=3 SV=1 49 116 5.0E-07
sp|Q5RAJ6|DJB11_PONAB DnaJ homolog subfamily B member 11 OS=Pongo abelii GN=DNAJB11 PE=2 SV=1 46 116 5.0E-07
sp|Q9UBS4|DJB11_HUMAN DnaJ homolog subfamily B member 11 OS=Homo sapiens GN=DNAJB11 PE=1 SV=1 46 116 5.0E-07
sp|Q73XZ6|DNAJ1_MYCPA Chaperone protein DnaJ 1 OS=Mycobacterium paratuberculosis (strain ATCC BAA-968 / K-10) GN=dnaJ1 PE=3 SV=1 52 116 5.0E-07
sp|Q6TUG0|DJB11_RAT DnaJ homolog subfamily B member 11 OS=Rattus norvegicus GN=Dnajb11 PE=2 SV=1 46 116 5.0E-07
sp|Q24SS4|DNAJ_DESHY Chaperone protein DnaJ OS=Desulfitobacterium hafniense (strain Y51) GN=dnaJ PE=3 SV=1 54 116 5.0E-07
sp|B8FUN3|DNAJ_DESHD Chaperone protein DnaJ OS=Desulfitobacterium hafniense (strain DCB-2 / DSM 10664) GN=dnaJ PE=3 SV=1 54 116 5.0E-07
sp|A1S8K6|DNAJ_SHEAM Chaperone protein DnaJ OS=Shewanella amazonensis (strain ATCC BAA-1098 / SB2B) GN=dnaJ PE=3 SV=1 54 116 5.0E-07
sp|Q2KWA4|DNAJ_BORA1 Chaperone protein DnaJ OS=Bordetella avium (strain 197N) GN=dnaJ PE=3 SV=1 51 116 5.0E-07
sp|Q5L6F7|DNAJ_CHLAB Chaperone protein DnaJ OS=Chlamydophila abortus (strain DSM 27085 / S26/3) GN=dnaJ PE=3 SV=1 53 116 5.0E-07
sp|Q823T2|DNAJ_CHLCV Chaperone protein DnaJ OS=Chlamydophila caviae (strain GPIC) GN=dnaJ PE=3 SV=1 54 116 5.0E-07
sp|B5ZWQ1|DNAJ_RHILW Chaperone protein DnaJ OS=Rhizobium leguminosarum bv. trifolii (strain WSM2304) GN=dnaJ PE=3 SV=1 51 116 6.0E-07
sp|Q2SYZ3|DNAJ_BURTA Chaperone protein DnaJ OS=Burkholderia thailandensis (strain E264 / ATCC 700388 / DSM 13276 / CIP 106301) GN=dnaJ PE=3 SV=1 51 116 6.0E-07
sp|B4EDZ1|DNAJ_BURCJ Chaperone protein DnaJ OS=Burkholderia cenocepacia (strain ATCC BAA-245 / DSM 16553 / LMG 16656 / NCTC 13227 / J2315 / CF5610) GN=dnaJ PE=3 SV=1 51 116 6.0E-07
sp|A0K4S9|DNAJ_BURCH Chaperone protein DnaJ OS=Burkholderia cenocepacia (strain HI2424) GN=dnaJ PE=3 SV=1 51 116 6.0E-07
sp|B1JW20|DNAJ_BURCC Chaperone protein DnaJ OS=Burkholderia cenocepacia (strain MC0-3) GN=dnaJ PE=3 SV=1 51 116 6.0E-07
sp|Q1BYX2|DNAJ_BURCA Chaperone protein DnaJ OS=Burkholderia cenocepacia (strain AU 1054) GN=dnaJ PE=3 SV=1 51 116 6.0E-07
sp|Q80Y75|DJB13_MOUSE DnaJ homolog subfamily B member 13 OS=Mus musculus GN=Dnajb13 PE=1 SV=1 54 116 6.0E-07
sp|Q3MG81|DNAJ_ANAVT Chaperone protein DnaJ OS=Anabaena variabilis (strain ATCC 29413 / PCC 7937) GN=dnaJ PE=3 SV=1 52 116 6.0E-07
sp|Q0BI17|DNAJ_BURCM Chaperone protein DnaJ OS=Burkholderia ambifaria (strain ATCC BAA-244 / AMMD) GN=dnaJ PE=3 SV=1 51 116 6.0E-07
sp|B1YTK1|DNAJ_BURA4 Chaperone protein DnaJ OS=Burkholderia ambifaria (strain MC40-6) GN=dnaJ PE=3 SV=1 51 116 6.0E-07
sp|Q9PQ82|DNAJ_UREPA Chaperone protein DnaJ OS=Ureaplasma parvum serovar 3 (strain ATCC 700970) GN=dnaJ PE=3 SV=1 51 116 6.0E-07
sp|P22305|DNAJ_CAUCR Chaperone protein DnaJ OS=Caulobacter crescentus (strain ATCC 19089 / CB15) GN=dnaJ PE=3 SV=2 54 116 6.0E-07
sp|A8FFD1|DNAJ_BACP2 Chaperone protein DnaJ OS=Bacillus pumilus (strain SAFR-032) GN=dnaJ PE=3 SV=1 54 116 6.0E-07
sp|Q63R47|DNAJ_BURPS Chaperone protein DnaJ OS=Burkholderia pseudomallei (strain K96243) GN=dnaJ PE=3 SV=1 51 116 6.0E-07
sp|Q3JP12|DNAJ_BURP1 Chaperone protein DnaJ OS=Burkholderia pseudomallei (strain 1710b) GN=dnaJ PE=3 SV=1 51 116 6.0E-07
sp|Q8YUA5|DNAJ_NOSS1 Chaperone protein DnaJ OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=dnaJ PE=3 SV=1 52 116 7.0E-07
sp|P0CW06|DNAJ_METMZ Chaperone protein DnaJ OS=Methanosarcina mazei GN=dnaJ PE=3 SV=1 49 116 7.0E-07
sp|P0CW07|DNAJ_METMA Chaperone protein DnaJ OS=Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88) GN=dnaJ PE=3 SV=1 49 116 7.0E-07
sp|A3ND66|DNAJ_BURP6 Chaperone protein DnaJ OS=Burkholderia pseudomallei (strain 668) GN=dnaJ PE=3 SV=1 51 116 7.0E-07
sp|A3NYX5|DNAJ_BURP0 Chaperone protein DnaJ OS=Burkholderia pseudomallei (strain 1106a) GN=dnaJ PE=3 SV=1 51 116 7.0E-07
sp|A1V0U8|DNAJ_BURMS Chaperone protein DnaJ OS=Burkholderia mallei (strain SAVP1) GN=dnaJ PE=3 SV=1 51 116 7.0E-07
sp|Q62HD6|DNAJ_BURMA Chaperone protein DnaJ OS=Burkholderia mallei (strain ATCC 23344) GN=dnaJ PE=3 SV=1 51 116 7.0E-07
sp|A2S563|DNAJ_BURM9 Chaperone protein DnaJ OS=Burkholderia mallei (strain NCTC 10229) GN=dnaJ PE=3 SV=1 51 116 7.0E-07
sp|A3MN97|DNAJ_BURM7 Chaperone protein DnaJ OS=Burkholderia mallei (strain NCTC 10247) GN=dnaJ PE=3 SV=1 51 116 7.0E-07
sp|Q91WN1|DNJC9_MOUSE DnaJ homolog subfamily C member 9 OS=Mus musculus GN=Dnajc9 PE=1 SV=2 54 124 7.0E-07
sp|Q87RX2|DNAJ_VIBPA Chaperone protein DnaJ OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) GN=dnaJ PE=3 SV=1 54 116 7.0E-07
sp|Q68XI3|DNAJ_RICTY Chaperone protein DnaJ OS=Rickettsia typhi (strain ATCC VR-144 / Wilmington) GN=dnaJ PE=3 SV=1 52 116 7.0E-07
sp|Q2KDW7|DNAJ_RHIEC Chaperone protein DnaJ OS=Rhizobium etli (strain CFN 42 / ATCC 51251) GN=dnaJ PE=3 SV=1 51 116 7.0E-07
sp|Q493S6|DNAJ_BLOPB Chaperone protein DnaJ OS=Blochmannia pennsylvanicus (strain BPEN) GN=dnaJ PE=3 SV=1 51 116 7.0E-07
sp|Q3A8C3|DNAJ_PELCD Chaperone protein DnaJ OS=Pelobacter carbinolicus (strain DSM 2380 / Gra Bd 1) GN=dnaJ PE=3 SV=1 54 116 7.0E-07
sp|Q8WXX5|DNJC9_HUMAN DnaJ homolog subfamily C member 9 OS=Homo sapiens GN=DNAJC9 PE=1 SV=1 54 136 7.0E-07
sp|C3LTA6|DNAJ_VIBCM Chaperone protein DnaJ OS=Vibrio cholerae serotype O1 (strain M66-2) GN=dnaJ PE=3 SV=1 54 116 7.0E-07
sp|O34242|DNAJ_VIBCH Chaperone protein DnaJ OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=dnaJ PE=3 SV=2 54 116 7.0E-07
sp|A5F362|DNAJ_VIBC3 Chaperone protein DnaJ OS=Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395) GN=dnaJ PE=3 SV=1 54 116 7.0E-07
sp|Q2JH49|DNAJ_SYNJB Chaperone protein DnaJ OS=Synechococcus sp. (strain JA-2-3B'a(2-13)) GN=dnaJ PE=3 SV=1 52 116 8.0E-07
sp|B9JZ89|DNAJ_AGRVS Chaperone protein DnaJ OS=Agrobacterium vitis (strain S4 / ATCC BAA-846) GN=dnaJ PE=3 SV=1 51 116 8.0E-07
sp|B1KRT1|DNAJ_SHEWM Chaperone protein DnaJ OS=Shewanella woodyi (strain ATCC 51908 / MS32) GN=dnaJ PE=3 SV=1 54 116 8.0E-07
sp|Q99KV1|DJB11_MOUSE DnaJ homolog subfamily B member 11 OS=Mus musculus GN=Dnajb11 PE=1 SV=1 46 116 8.0E-07
sp|B0U833|DNAJ_METS4 Chaperone protein DnaJ OS=Methylobacterium sp. (strain 4-46) GN=dnaJ PE=3 SV=1 54 116 8.0E-07
sp|A1TLH8|DNAJ_ACIAC Chaperone protein DnaJ OS=Acidovorax citrulli (strain AAC00-1) GN=dnaJ PE=3 SV=1 54 116 8.0E-07
sp|A1STE5|DNAJ_PSYIN Chaperone protein DnaJ OS=Psychromonas ingrahamii (strain 37) GN=dnaJ PE=3 SV=1 51 116 9.0E-07
sp|Q0AIY0|DNAJ_NITEC Chaperone protein DnaJ OS=Nitrosomonas eutropha (strain C91) GN=dnaJ PE=3 SV=1 54 116 9.0E-07
sp|P75354|DNAJM_MYCPN DnaJ-like protein MG200 homolog OS=Mycoplasma pneumoniae (strain ATCC 29342 / M129) GN=MPN_119 PE=3 SV=1 51 116 9.0E-07
sp|B1XQF6|DNAJ_SYNP2 Chaperone protein DnaJ OS=Synechococcus sp. (strain ATCC 27264 / PCC 7002 / PR-6) GN=dnaJ PE=3 SV=1 52 116 9.0E-07
sp|Q8XIT1|DNAJ_CLOPE Chaperone protein DnaJ OS=Clostridium perfringens (strain 13 / Type A) GN=dnaJ PE=3 SV=1 51 116 9.0E-07
sp|Q9LZK5|DNJ19_ARATH DnaJ protein ERDJ3B OS=Arabidopsis thaliana GN=ERDJ3B PE=1 SV=1 49 116 9.0E-07
sp|Q9HV44|DNAJ_PSEAE Chaperone protein DnaJ OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=dnaJ PE=3 SV=1 51 116 1.0E-06
sp|Q02FR2|DNAJ_PSEAB Chaperone protein DnaJ OS=Pseudomonas aeruginosa (strain UCBPP-PA14) GN=dnaJ PE=3 SV=1 51 116 1.0E-06
sp|B7V1H2|DNAJ_PSEA8 Chaperone protein DnaJ OS=Pseudomonas aeruginosa (strain LESB58) GN=dnaJ PE=3 SV=1 51 116 1.0E-06
sp|Q5NPS5|DNAJ_ZYMMO Chaperone protein DnaJ OS=Zymomonas mobilis subsp. mobilis (strain ATCC 31821 / ZM4 / CP4) GN=dnaJ PE=3 SV=1 54 116 1.0E-06
sp|B5ENA2|DNAJ_ACIF5 Chaperone protein DnaJ OS=Acidithiobacillus ferrooxidans (strain ATCC 53993) GN=dnaJ PE=3 SV=1 51 116 1.0E-06
sp|B7J7X8|DNAJ_ACIF2 Chaperone protein DnaJ OS=Acidithiobacillus ferrooxidans (strain ATCC 23270 / DSM 14882 / CIP 104768 / NCIMB 8455) GN=dnaJ PE=3 SV=1 51 116 1.0E-06
sp|A1V9Q3|DNAJ_DESVV Chaperone protein DnaJ OS=Desulfovibrio vulgaris subsp. vulgaris (strain DP4) GN=dnaJ PE=3 SV=1 54 116 1.0E-06
sp|Q725M6|DNAJ_DESVH Chaperone protein DnaJ OS=Desulfovibrio vulgaris (strain Hildenborough / ATCC 29579 / NCIMB 8303) GN=dnaJ PE=3 SV=1 54 116 1.0E-06
sp|Q21H37|DNAJ_SACD2 Chaperone protein DnaJ OS=Saccharophagus degradans (strain 2-40 / ATCC 43961 / DSM 17024) GN=dnaJ PE=3 SV=1 54 116 1.0E-06
sp|B8CKF4|DNAJ_SHEPW Chaperone protein DnaJ OS=Shewanella piezotolerans (strain WP3 / JCM 13877) GN=dnaJ PE=3 SV=1 54 116 1.0E-06
sp|Q47XI7|DNAJ_COLP3 Chaperone protein DnaJ OS=Colwellia psychrerythraea (strain 34H / ATCC BAA-681) GN=dnaJ PE=3 SV=1 54 116 1.0E-06
sp|C8V213|MDJ1_EMENI DnaJ homolog 1, mitochondrial OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=AN10778 PE=3 SV=1 49 116 1.0E-06
sp|A6VCL7|DNAJ_PSEA7 Chaperone protein DnaJ OS=Pseudomonas aeruginosa (strain PA7) GN=dnaJ PE=3 SV=1 51 116 1.0E-06
sp|Q2GLU9|DNAJ_ANAPZ Chaperone protein DnaJ OS=Anaplasma phagocytophilum (strain HZ) GN=dnaJ PE=3 SV=1 51 116 1.0E-06
sp|C6DF09|DNAJ_PECCP Chaperone protein DnaJ OS=Pectobacterium carotovorum subsp. carotovorum (strain PC1) GN=dnaJ PE=3 SV=1 51 116 1.0E-06
sp|P59910|DJB13_HUMAN DnaJ homolog subfamily B member 13 OS=Homo sapiens GN=DNAJB13 PE=2 SV=1 51 116 1.0E-06
sp|Q9TVP3|JDP_DROME J domain-containing protein OS=Drosophila melanogaster GN=jdp PE=2 SV=2 53 116 1.0E-06
sp|P47442|DNAJM_MYCGE DnaJ-like protein MG200 OS=Mycoplasma genitalium (strain ATCC 33530 / G-37 / NCTC 10195) GN=MG200 PE=1 SV=1 54 116 1.0E-06
sp|Q2S030|DNAJ_SALRD Chaperone protein DnaJ OS=Salinibacter ruber (strain DSM 13855 / M31) GN=dnaJ PE=3 SV=1 54 116 1.0E-06
sp|Q316U7|DNAJ_DESAG Chaperone protein DnaJ OS=Desulfovibrio alaskensis (strain G20) GN=dnaJ PE=3 SV=1 54 116 1.0E-06
sp|A9MR76|DNAJ_SALAR Chaperone protein DnaJ OS=Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980) GN=dnaJ PE=3 SV=1 51 116 1.0E-06
sp|Q6PGY5|DJC21_DANRE DnaJ homolog subfamily C member 21 OS=Danio rerio GN=dnajc21 PE=2 SV=1 56 117 1.0E-06
sp|B8IHL2|DNAJ_METNO Chaperone protein DnaJ OS=Methylobacterium nodulans (strain ORS2060 / LMG 21967) GN=dnaJ PE=3 SV=1 54 116 1.0E-06
sp|Q6G553|DNAJ_BARHE Chaperone protein DnaJ OS=Bartonella henselae (strain ATCC 49882 / DSM 28221 / Houston 1) GN=dnaJ PE=3 SV=1 54 116 1.0E-06
sp|Q6D0B8|DNAJ_PECAS Chaperone protein DnaJ OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) GN=dnaJ PE=3 SV=1 51 116 1.0E-06
sp|Q8WW22|DNJA4_HUMAN DnaJ homolog subfamily A member 4 OS=Homo sapiens GN=DNAJA4 PE=1 SV=1 56 116 1.0E-06
sp|B2IBR5|DNAJ_BEII9 Chaperone protein DnaJ OS=Beijerinckia indica subsp. indica (strain ATCC 9039 / DSM 1715 / NCIB 8712) GN=dnaJ PE=3 SV=1 51 116 1.0E-06
sp|O42196|DNJC5_XENLA DnaJ homolog subfamily C member 5 OS=Xenopus laevis GN=dnajc5 PE=2 SV=1 51 116 1.0E-06
sp|O52065|DNAJ_MANHA Chaperone protein DnaJ OS=Mannheimia haemolytica GN=dnaJ PE=3 SV=1 51 116 1.0E-06
sp|Q6AN63|DNAJ_DESPS Chaperone protein DnaJ OS=Desulfotalea psychrophila (strain LSv54 / DSM 12343) GN=dnaJ PE=3 SV=1 54 116 1.0E-06
sp|A4WW88|DNAJ_RHOS5 Chaperone protein DnaJ OS=Rhodobacter sphaeroides (strain ATCC 17025 / ATH 2.4.3) GN=dnaJ PE=3 SV=1 51 116 1.0E-06
sp|B9KPP3|DNAJ_RHOSK Chaperone protein DnaJ OS=Rhodobacter sphaeroides (strain KD131 / KCTC 12085) GN=dnaJ PE=3 SV=1 51 116 2.0E-06
sp|Q3IYM8|DNAJ_RHOS4 Chaperone protein DnaJ OS=Rhodobacter sphaeroides (strain ATCC 17023 / 2.4.1 / NCIB 8253 / DSM 158) GN=dnaJ PE=3 SV=1 51 116 2.0E-06
sp|A5IIT4|DNAJ_THEP1 Chaperone protein DnaJ OS=Thermotoga petrophila (strain RKU-1 / ATCC BAA-488 / DSM 13995) GN=dnaJ PE=3 SV=1 53 116 2.0E-06
sp|A3PNM0|DNAJ_RHOS1 Chaperone protein DnaJ OS=Rhodobacter sphaeroides (strain ATCC 17029 / ATH 2.4.9) GN=dnaJ PE=3 SV=1 51 116 2.0E-06
sp|Q8EUM4|DNAJ_MYCPE Chaperone protein DnaJ OS=Mycoplasma penetrans (strain HF-2) GN=dnaJ PE=3 SV=1 49 116 2.0E-06
sp|P42381|DNAJ_COXBU Chaperone protein DnaJ OS=Coxiella burnetii (strain RSA 493 / Nine Mile phase I) GN=dnaJ PE=3 SV=2 51 116 2.0E-06
sp|Q29455|DNJC5_BOVIN DnaJ homolog subfamily C member 5 OS=Bos taurus GN=DNAJC5 PE=2 SV=1 51 116 2.0E-06
sp|Q9H3Z4|DNJC5_HUMAN DnaJ homolog subfamily C member 5 OS=Homo sapiens GN=DNAJC5 PE=1 SV=1 51 116 2.0E-06
sp|P73097|DNAJ2_SYNY3 Chaperone protein DnaJ 2 OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=dnaJ2 PE=3 SV=1 49 119 2.0E-06
sp|B1LCI2|DNAJ_THESQ Chaperone protein DnaJ OS=Thermotoga sp. (strain RQ2) GN=dnaJ PE=3 SV=1 53 116 2.0E-06
sp|A9N8H1|DNAJ_COXBR Chaperone protein DnaJ OS=Coxiella burnetii (strain RSA 331 / Henzerling II) GN=dnaJ PE=3 SV=1 51 116 2.0E-06
sp|P60905|DNJC5_RAT DnaJ homolog subfamily C member 5 OS=Rattus norvegicus GN=Dnajc5 PE=1 SV=1 51 116 2.0E-06
sp|P60904|DNJC5_MOUSE DnaJ homolog subfamily C member 5 OS=Mus musculus GN=Dnajc5 PE=1 SV=1 51 116 2.0E-06
sp|Q9D844|DNJC4_MOUSE DnaJ homolog subfamily C member 4 OS=Mus musculus GN=Dnajc4 PE=2 SV=2 44 148 2.0E-06
sp|Q4KIH0|DNAJ_PSEF5 Chaperone protein DnaJ OS=Pseudomonas fluorescens (strain Pf-5 / ATCC BAA-477) GN=dnaJ PE=3 SV=1 51 116 2.0E-06
sp|Q3ZBA6|DJB11_BOVIN DnaJ homolog subfamily B member 11 OS=Bos taurus GN=DNAJB11 PE=2 SV=1 46 116 2.0E-06
sp|A8FYT9|DNAJ_SHESH Chaperone protein DnaJ OS=Shewanella sediminis (strain HAW-EB3) GN=dnaJ PE=3 SV=1 54 116 2.0E-06
sp|Q9WZV3|DNAJ_THEMA Chaperone protein DnaJ OS=Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099) GN=dnaJ PE=3 SV=1 53 116 2.0E-06
sp|A9KKT9|DNAJ_CLOPH Chaperone protein DnaJ OS=Clostridium phytofermentans (strain ATCC 700394 / DSM 18823 / ISDg) GN=dnaJ PE=3 SV=1 49 116 2.0E-06
sp|Q8D2Q6|DNAJ_WIGBR Chaperone protein DnaJ OS=Wigglesworthia glossinidia brevipalpis GN=dnaJ PE=3 SV=1 51 116 2.0E-06
sp|Q55505|DNAJ1_SYNY3 Chaperone protein DnaJ 1 OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=dnaJ1 PE=3 SV=1 54 116 2.0E-06
sp|Q5YNI2|DNAJ2_NOCFA Chaperone protein DnaJ 2 OS=Nocardia farcinica (strain IFM 10152) GN=dnaJ2 PE=3 SV=1 53 118 2.0E-06
sp|Q6G1F8|DNAJ_BARQU Chaperone protein DnaJ OS=Bartonella quintana (strain Toulouse) GN=dnaJ PE=3 SV=1 54 116 2.0E-06
sp|P9WNV7|DNAJ2_MYCTU Chaperone protein DnaJ 2 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=dnaJ2 PE=1 SV=1 52 116 2.0E-06
sp|P9WNV6|DNAJ2_MYCTO Chaperone protein DnaJ 2 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=dnaJ2 PE=3 SV=1 52 116 2.0E-06
sp|P63967|DNAJ2_MYCBO Chaperone protein DnaJ 2 OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=dnaJ2 PE=3 SV=1 52 116 2.0E-06
sp|A1K4C4|DNAJ_AZOSB Chaperone protein DnaJ OS=Azoarcus sp. (strain BH72) GN=dnaJ PE=3 SV=1 54 116 2.0E-06
sp|Q1QET5|DNAJ_PSYCK Chaperone protein DnaJ OS=Psychrobacter cryohalolentis (strain K5) GN=dnaJ PE=3 SV=1 54 116 2.0E-06
sp|B0JW23|DNAJ_MICAN Chaperone protein DnaJ OS=Microcystis aeruginosa (strain NIES-843) GN=dnaJ PE=3 SV=1 54 162 2.0E-06
sp|Q8KRC9|DNAJ_MYXXA Chaperone protein DnaJ OS=Myxococcus xanthus GN=dnaJ PE=3 SV=1 52 116 2.0E-06
sp|A9HEA1|DNAJ_GLUDA Chaperone protein DnaJ OS=Gluconacetobacter diazotrophicus (strain ATCC 49037 / DSM 5601 / PAl5) GN=dnaJ PE=3 SV=1 49 116 2.0E-06
sp|B2UBP2|DNAJ_RALPJ Chaperone protein DnaJ OS=Ralstonia pickettii (strain 12J) GN=dnaJ PE=3 SV=1 51 116 3.0E-06
sp|Q3J7D9|DNAJ_NITOC Chaperone protein DnaJ OS=Nitrosococcus oceani (strain ATCC 19707 / NCIMB 11848) GN=dnaJ PE=3 SV=1 51 116 3.0E-06
sp|Q50312|DNAJL_MYCPN DnaJ-like protein MG002 homolog OS=Mycoplasma pneumoniae (strain ATCC 29342 / M129) GN=MPN_002 PE=3 SV=1 55 119 3.0E-06
sp|Q2VYT0|DNAJ_MAGSA Chaperone protein DnaJ OS=Magnetospirillum magneticum (strain AMB-1 / ATCC 700264) GN=dnaJ PE=3 SV=1 53 116 3.0E-06
sp|Q9QYI4|DJB12_MOUSE DnaJ homolog subfamily B member 12 OS=Mus musculus GN=Dnajb12 PE=1 SV=2 39 116 3.0E-06
sp|Q5U458|DJC11_MOUSE DnaJ homolog subfamily C member 11 OS=Mus musculus GN=Dnajc11 PE=1 SV=2 53 116 3.0E-06
sp|Q3SIN3|DNAJ_THIDA Chaperone protein DnaJ OS=Thiobacillus denitrificans (strain ATCC 25259) GN=dnaJ PE=3 SV=1 54 116 3.0E-06
sp|Q9NVH1|DJC11_HUMAN DnaJ homolog subfamily C member 11 OS=Homo sapiens GN=DNAJC11 PE=1 SV=2 53 116 3.0E-06
sp|Q5RC70|DJC11_PONAB DnaJ homolog subfamily C member 11 OS=Pongo abelii GN=DNAJC11 PE=2 SV=1 53 116 3.0E-06
sp|A4XYF5|DNAJ_PSEMY Chaperone protein DnaJ OS=Pseudomonas mendocina (strain ymp) GN=dnaJ PE=3 SV=1 51 116 3.0E-06
sp|Q2SMM7|DNAJ_HAHCH Chaperone protein DnaJ OS=Hahella chejuensis (strain KCTC 2396) GN=dnaJ PE=3 SV=1 51 116 3.0E-06
sp|A8IPT0|DNAJ_AZOC5 Chaperone protein DnaJ OS=Azorhizobium caulinodans (strain ATCC 43989 / DSM 5975 / JCM 20966 / NBRC 14845 / NCIMB 13405 / ORS 571) GN=dnaJ PE=3 SV=1 51 116 4.0E-06
sp|Q6F6R1|DNAJ_ACIAD Chaperone protein DnaJ OS=Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1) GN=dnaJ PE=3 SV=1 51 116 4.0E-06
sp|O94625|SPJ1_SCHPO DnaJ-related protein spj1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=spj1 PE=2 SV=2 59 116 4.0E-06
sp|A0KTS6|DNAJ_SHESA Chaperone protein DnaJ OS=Shewanella sp. (strain ANA-3) GN=dnaJ PE=3 SV=1 54 116 4.0E-06
sp|C1DFM2|DNAJ_AZOVD Chaperone protein DnaJ OS=Azotobacter vinelandii (strain DJ / ATCC BAA-1303) GN=dnaJ PE=3 SV=1 51 116 4.0E-06
sp|Q9Z9E9|DNAJ_CHLPN Chaperone protein DnaJ OS=Chlamydia pneumoniae GN=dnaJ PE=3 SV=1 54 116 4.0E-06
sp|B0VA24|DNAJ_ACIBY Chaperone protein DnaJ OS=Acinetobacter baumannii (strain AYE) GN=dnaJ PE=3 SV=1 51 116 4.0E-06
sp|A3MA88|DNAJ_ACIBT Chaperone protein DnaJ OS=Acinetobacter baumannii (strain ATCC 17978 / CIP 53.77 / LMG 1025 / NCDC KC755 / 5377) GN=dnaJ PE=3 SV=2 51 116 4.0E-06
sp|B0VQ00|DNAJ_ACIBS Chaperone protein DnaJ OS=Acinetobacter baumannii (strain SDF) GN=dnaJ PE=3 SV=1 51 116 4.0E-06
sp|B2I2G6|DNAJ_ACIBC Chaperone protein DnaJ OS=Acinetobacter baumannii (strain ACICU) GN=dnaJ PE=3 SV=1 51 116 4.0E-06
sp|B7I2B2|DNAJ_ACIB5 Chaperone protein DnaJ OS=Acinetobacter baumannii (strain AB0057) GN=dnaJ PE=3 SV=1 51 116 4.0E-06
sp|B7GV08|DNAJ_ACIB3 Chaperone protein DnaJ OS=Acinetobacter baumannii (strain AB307-0294) GN=dnaJ PE=3 SV=1 51 116 4.0E-06
sp|Q8GYX8|DNJ10_ARATH Chaperone protein dnaJ 10 OS=Arabidopsis thaliana GN=ATJ10 PE=2 SV=2 54 129 4.0E-06
sp|Q8EHT6|DNAJ_SHEON Chaperone protein DnaJ OS=Shewanella oneidensis (strain MR-1) GN=dnaJ PE=3 SV=1 54 116 4.0E-06
sp|Q2GI75|DNAJ_EHRCR Chaperone protein DnaJ OS=Ehrlichia chaffeensis (strain ATCC CRL-10679 / Arkansas) GN=dnaJ PE=3 SV=1 54 116 4.0E-06
sp|Q0HY10|DNAJ_SHESR Chaperone protein DnaJ OS=Shewanella sp. (strain MR-7) GN=dnaJ PE=3 SV=1 54 116 4.0E-06
sp|Q0HLM9|DNAJ_SHESM Chaperone protein DnaJ OS=Shewanella sp. (strain MR-4) GN=dnaJ PE=3 SV=1 54 116 4.0E-06
sp|Q2NL21|DJC11_BOVIN DnaJ homolog subfamily C member 11 OS=Bos taurus GN=DNAJC11 PE=2 SV=1 53 116 4.0E-06
sp|Q4FVQ7|DNAJ_PSYA2 Chaperone protein DnaJ OS=Psychrobacter arcticus (strain DSM 17307 / 273-4) GN=dnaJ PE=3 SV=1 54 116 4.0E-06
sp|Q5YZX0|DNAJ1_NOCFA Chaperone protein DnaJ 1 OS=Nocardia farcinica (strain IFM 10152) GN=dnaJ1 PE=3 SV=1 52 116 4.0E-06
sp|B2J3J3|DNAJ_NOSP7 Chaperone protein DnaJ OS=Nostoc punctiforme (strain ATCC 29133 / PCC 73102) GN=dnaJ PE=3 SV=1 52 116 5.0E-06
sp|Q7VQL3|DNAJ_BLOFL Chaperone protein DnaJ OS=Blochmannia floridanus GN=dnaJ PE=3 SV=1 54 116 5.0E-06
sp|Q4ZNP8|DNAJ_PSEU2 Chaperone protein DnaJ OS=Pseudomonas syringae pv. syringae (strain B728a) GN=dnaJ PE=3 SV=1 51 116 5.0E-06
sp|Q48E63|DNAJ_PSE14 Chaperone protein DnaJ OS=Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6) GN=dnaJ PE=3 SV=1 51 116 5.0E-06
sp|Q87WP1|DNAJ_PSESM Chaperone protein DnaJ OS=Pseudomonas syringae pv. tomato (strain DC3000) GN=dnaJ PE=3 SV=1 51 116 5.0E-06
sp|A3QGW1|DNAJ_SHELP Chaperone protein DnaJ OS=Shewanella loihica (strain ATCC BAA-1088 / PV-4) GN=dnaJ PE=3 SV=1 54 116 5.0E-06
sp|P81999|DJB11_CANLF DnaJ homolog subfamily B member 11 OS=Canis lupus familiaris GN=DNAJB11 PE=1 SV=2 47 116 5.0E-06
sp|Q1IF58|DNAJ_PSEE4 Chaperone protein DnaJ OS=Pseudomonas entomophila (strain L48) GN=dnaJ PE=3 SV=1 51 116 6.0E-06
sp|Q7V3Q3|DNAJ_PROMP Chaperone protein DnaJ OS=Prochlorococcus marinus subsp. pastoris (strain CCMP1986 / MED4) GN=dnaJ PE=3 SV=1 54 116 6.0E-06
sp|P77866|DNAJ_AGGAC Chaperone protein DnaJ OS=Aggregatibacter actinomycetemcomitans GN=dnaJ PE=3 SV=2 51 116 6.0E-06
sp|Q2KI83|DJC17_BOVIN DnaJ homolog subfamily C member 17 OS=Bos taurus GN=DNAJC17 PE=2 SV=1 54 139 7.0E-06
sp|O89114|DNJB5_MOUSE DnaJ homolog subfamily B member 5 OS=Mus musculus GN=Dnajb5 PE=2 SV=1 51 116 7.0E-06
sp|Q5BIP8|DNJB5_BOVIN DnaJ homolog subfamily B member 5 OS=Bos taurus GN=DNAJB5 PE=2 SV=1 52 116 7.0E-06
sp|O75953|DNJB5_HUMAN DnaJ homolog subfamily B member 5 OS=Homo sapiens GN=DNAJB5 PE=1 SV=1 51 116 8.0E-06
sp|B8HLD2|DNAJ_CYAP4 Chaperone protein DnaJ OS=Cyanothece sp. (strain PCC 7425 / ATCC 29141) GN=dnaJ PE=3 SV=1 52 116 8.0E-06
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 26 0.45

Transmembrane Domains

Domain # Start End Length
1 262 284 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|6193
MPPPSPLRIVATTWMPAARHRRCCCYRRLLHVSRTLFQEAGAGAGAGGVAAAQDLYGRLRVRRDASTAEIKRSFY
ALSKTHHPDVNRSNPDASTTFSLLADAYATLSDPVRRAAYDGTLSPPASSKPASPSLTRRRTTTFRGPAPSFYRN
GGWGLHAAARRRAHEESTGFRSRSPSADDDPPSSAGSRRDGEPFPRQPGMGPGQYPFRFSEHDPISHPPPPHFNR
QAHTRTHEREDQRRWQRSRRSRASDLDGQEFEPETGPAGNFLIVATILGATLFAPFVYLQFSRLDFRPRDSH
Coding >Ophio5|6193
ATGCCGCCGCCGTCGCCGCTCCGCATCGTCGCGACGACTTGGATGCCGGCTGCTCGTCACCGTCGCTGCTGCTGC
TATCGTCGGCTTCTGCATGTGTCGCGGACGCTGTTTCAGGAGGCGGGTGCGGGTGCGGGTGCGGGGGGAGTGGCG
GCGGCGCAGGATCTCTATGGTAGGCTGCGGGTGAGGAGGGACGCTTCCACTGCCGAGATCAAGAGATCCTTTTAC
GCCCTCTCCAAAACGCACCACCCGGACGTCAACCGCTCCAACCCAGACGCATCGACGACCTTCTCCCTACTAGCG
GACGCATACGCCACCCTATCCGACCCAGTCCGACGCGCCGCCTACGACGGCACGCTAAGCCCTCCCGCCTCTTCC
AAGCCGGCTTCTCCCTCACTGACTCGTCGTCGTACCACCACCTTTCGCGGCCCGGCTCCTAGCTTCTATCGCAAC
GGCGGCTGGGGCCTGCACGCCGCTGCGAGACGACGCGCTCACGAGGAATCTACCGGCTTTCGGTCTCGCTCTCCA
TCGGCTGATGATGATCCCCCTTCTTCCGCCGGCTCGAGGAGAGACGGAGAGCCGTTTCCTCGTCAGCCTGGTATG
GGTCCCGGCCAGTATCCCTTTCGATTCTCTGAGCATGATCCCATCTCTCACCCTCCTCCGCCGCACTTTAACCGC
CAGGCTCACACTCGAACACATGAGCGCGAGGATCAACGACGCTGGCAGCGTAGTAGAAGAAGTCGCGCTTCCGAC
CTCGACGGGCAAGAATTCGAACCGGAGACGGGCCCGGCTGGCAATTTCCTCATCGTCGCTACCATCCTTGGTGCT
ACCCTGTTCGCGCCTTTTGTCTATCTTCAGTTTTCCCGCTTGGACTTTCGGCCCAGAGATTCTCAC
Transcript >Ophio5|6193
ATGCCGCCGCCGTCGCCGCTCCGCATCGTCGCGACGACTTGGATGCCGGCTGCTCGTCACCGTCGCTGCTGCTGC
TATCGTCGGCTTCTGCATGTGTCGCGGACGCTGTTTCAGGAGGCGGGTGCGGGTGCGGGTGCGGGGGGAGTGGCG
GCGGCGCAGGATCTCTATGGTAGGCTGCGGGTGAGGAGGGACGCTTCCACTGCCGAGATCAAGAGATCCTTTTAC
GCCCTCTCCAAAACGCACCACCCGGACGTCAACCGCTCCAACCCAGACGCATCGACGACCTTCTCCCTACTAGCG
GACGCATACGCCACCCTATCCGACCCAGTCCGACGCGCCGCCTACGACGGCACGCTAAGCCCTCCCGCCTCTTCC
AAGCCGGCTTCTCCCTCACTGACTCGTCGTCGTACCACCACCTTTCGCGGCCCGGCTCCTAGCTTCTATCGCAAC
GGCGGCTGGGGCCTGCACGCCGCTGCGAGACGACGCGCTCACGAGGAATCTACCGGCTTTCGGTCTCGCTCTCCA
TCGGCTGATGATGATCCCCCTTCTTCCGCCGGCTCGAGGAGAGACGGAGAGCCGTTTCCTCGTCAGCCTGGTATG
GGTCCCGGCCAGTATCCCTTTCGATTCTCTGAGCATGATCCCATCTCTCACCCTCCTCCGCCGCACTTTAACCGC
CAGGCTCACACTCGAACACATGAGCGCGAGGATCAACGACGCTGGCAGCGTAGTAGAAGAAGTCGCGCTTCCGAC
CTCGACGGGCAAGAATTCGAACCGGAGACGGGCCCGGCTGGCAATTTCCTCATCGTCGCTACCATCCTTGGTGCT
ACCCTGTTCGCGCCTTTTGTCTATCTTCAGTTTTCCCGCTTGGACTTTCGGCCCAGAGATTCTCACTGA
Gene >Ophio5|6193
ATGCCGCCGCCGTCGCCGCTCCGCATCGTCGCGACGACTTGGATGCCGGCTGCTCGTCACCGTCGCTGCTGCTGC
TATCGTCGGCTTCTGCATGTGTCGCGGACGCTGTTTCAGGAGGCGGGTGCGGGTGCGGGTGCGGGGGGAGTGGCG
GCGGCGCAGGATCTCTATGGTAGGCTGCGGGTGAGGAGGGACGCTTCCACTGCCGAGATCAAGAGGTGAATATTC
CCGCTTCTATACGCCCCCCCATCTCCATGCCCTCCCTCACACCCCAGTCGATAGATCCTTTTACGCCCTCTCCAA
AACGCACCACCCGGACGTCAACCGCTCCAACCCAGACGCATCGACGACCTTCTCCCTACTAGCGGACGCATACGC
CACCCTATCCGACCCAGTCCGACGCGCCGCCTACGACGGCACGCTAAGCCCTCCCGCCTCTTCCAAGCCGGCTTC
TCCCTCACTGACTCGTCGTCGTACCACCACCTTTCGCGGCCCGGCTCCTAGCTTCTATCGCAACGGCGGCTGGGG
CCTGCACGCCGCTGCGAGACGACGCGCTCACGAGGAATCTACCGGCTTTCGGTCTCGCTCTCCATCGGCTGATGA
TGATCCCCCTTCTTCCGCCGGCTCGAGGAGAGACGGAGAGCCGTTTCCTCGTCAGCCTGGTATGGGTCCCGGCCA
GTATCCCTTTCGATTCTCTGAGCATGATCCCATCTCTCACCCTCCTCCGCCGCACTTTAACCGCCAGGCTCACAC
TCGAACACATGAGCGCGAGGATCAACGACGCTGGCAGCGTAGTAGAAGAAGTCGCGCTTCCGACCTCGACGGGCA
AGAATTCGAACCGGAGACGGGCCCGGCTGGCAATTTCCTCATCGTCGCTACCATCCTTGGTGCTACCCTGTTCGC
GCCTTTTGTCTATCTTCAGTTTTCCCGCTTGGACTTTCGGCCCAGAGATTCTCACTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail