Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|6189
Gene name
Locationscaffold_53:16961..17962
Strand-
Gene length (bp)1001
Transcript length (bp)927
Coding sequence length (bp)924
Protein length (aa) 308

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00804 Syntaxin Syntaxin 7.0E-27 47 236
PF05739 SNARE SNARE domain 2.1E-13 239 289

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9USH7|PSY1_SCHPO Syntaxin-like protein psy1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=psy1 PE=3 SV=1 47 279 4.0E-35
sp|Q59YF0|SSO2_CANAL Protein transport protein SSO2 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=SSO2 PE=3 SV=1 1 303 2.0E-26
sp|P39926|SSO2_YEAST Protein SSO2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SSO2 PE=1 SV=2 12 286 1.0E-24
sp|P32867|SSO1_YEAST Protein SSO1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SSO1 PE=1 SV=2 15 280 1.0E-23
sp|P61268|STX1B_SHEEP Syntaxin-1B OS=Ovis aries GN=STX1B PE=2 SV=1 47 300 6.0E-22
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9USH7|PSY1_SCHPO Syntaxin-like protein psy1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=psy1 PE=3 SV=1 47 279 4.0E-35
sp|Q59YF0|SSO2_CANAL Protein transport protein SSO2 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=SSO2 PE=3 SV=1 1 303 2.0E-26
sp|P39926|SSO2_YEAST Protein SSO2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SSO2 PE=1 SV=2 12 286 1.0E-24
sp|P32867|SSO1_YEAST Protein SSO1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SSO1 PE=1 SV=2 15 280 1.0E-23
sp|P61268|STX1B_SHEEP Syntaxin-1B OS=Ovis aries GN=STX1B PE=2 SV=1 47 300 6.0E-22
sp|P61267|STX1B_BOVIN Syntaxin-1B OS=Bos taurus GN=STX1B PE=1 SV=1 47 300 6.0E-22
sp|P61265|STX1B_RAT Syntaxin-1B OS=Rattus norvegicus GN=Stx1b PE=1 SV=1 47 300 3.0E-21
sp|P61264|STX1B_MOUSE Syntaxin-1B OS=Mus musculus GN=Stx1b PE=1 SV=1 47 300 3.0E-21
sp|P61266|STX1B_HUMAN Syntaxin-1B OS=Homo sapiens GN=STX1B PE=1 SV=1 47 300 3.0E-21
sp|P32850|STX1A_BOVIN Syntaxin-1A OS=Bos taurus GN=STX1A PE=1 SV=1 47 300 2.0E-19
sp|P32851|STX1A_RAT Syntaxin-1A OS=Rattus norvegicus GN=Stx1a PE=1 SV=1 47 300 2.0E-19
sp|O35526|STX1A_MOUSE Syntaxin-1A OS=Mus musculus GN=Stx1a PE=1 SV=3 47 300 3.0E-19
sp|Q16623|STX1A_HUMAN Syntaxin-1A OS=Homo sapiens GN=STX1A PE=1 SV=1 47 296 8.0E-19
sp|Q16932|STX_APLCA Syntaxin OS=Aplysia californica PE=2 SV=1 45 279 1.0E-18
sp|Q5R4L2|STX1A_PONAB Syntaxin-1A OS=Pongo abelii GN=STX1A PE=2 SV=1 47 296 2.0E-18
sp|P32856|STX2_HUMAN Syntaxin-2 OS=Homo sapiens GN=STX2 PE=2 SV=3 38 297 4.0E-18
sp|Q08850|STX4_RAT Syntaxin-4 OS=Rattus norvegicus GN=Stx4 PE=1 SV=1 47 294 2.0E-16
sp|P70452|STX4_MOUSE Syntaxin-4 OS=Mus musculus GN=Stx4 PE=1 SV=1 28 294 4.0E-16
sp|O16000|STX1A_CAEEL Syntaxin-1A homolog OS=Caenorhabditis elegans GN=unc-64 PE=1 SV=1 45 293 7.0E-16
sp|Q24547|STX1A_DROME Syntaxin-1A OS=Drosophila melanogaster GN=Syx1A PE=1 SV=1 47 289 3.0E-15
sp|Q13277|STX3_HUMAN Syntaxin-3 OS=Homo sapiens GN=STX3 PE=1 SV=3 47 300 9.0E-15
sp|Q64704|STX3_MOUSE Syntaxin-3 OS=Mus musculus GN=Stx3 PE=1 SV=1 47 273 2.0E-14
sp|Q08849|STX3_RAT Syntaxin-3 OS=Rattus norvegicus GN=Stx3 PE=2 SV=1 47 273 2.0E-14
sp|Q12846|STX4_HUMAN Syntaxin-4 OS=Homo sapiens GN=STX4 PE=1 SV=2 28 293 7.0E-14
sp|A8WVD0|STX1A_CAEBR Syntaxin-1A OS=Caenorhabditis briggsae GN=unc-64 PE=3 SV=1 45 275 8.0E-13
sp|Q00262|STX2_MOUSE Syntaxin-2 OS=Mus musculus GN=Stx2 PE=1 SV=1 47 276 2.0E-12
sp|P50279|STX2_RAT Syntaxin-2 OS=Rattus norvegicus GN=Stx2 PE=1 SV=2 46 276 2.0E-12
sp|Q9SRV7|SY131_ARATH Putative syntaxin-131 OS=Arabidopsis thaliana GN=SYP131 PE=3 SV=1 5 278 3.0E-12
sp|Q3SWZ3|STX4_BOVIN Syntaxin-4 OS=Bos taurus GN=STX4 PE=2 SV=1 29 281 3.0E-11
sp|Q20024|STX3_CAEEL Putative syntaxin-3 OS=Caenorhabditis elegans GN=syx-3 PE=3 SV=3 27 304 7.0E-11
sp|O64791|SY124_ARATH Syntaxin-124 OS=Arabidopsis thaliana GN=SYP124 PE=2 SV=1 42 287 1.0E-10
sp|Q9SXB0|SY125_ARATH Syntaxin-125 OS=Arabidopsis thaliana GN=SYP125 PE=2 SV=1 42 278 3.0E-10
sp|O75558|STX11_HUMAN Syntaxin-11 OS=Homo sapiens GN=STX11 PE=1 SV=1 12 278 3.0E-10
sp|Q9ZQZ8|SY123_ARATH Syntaxin-123 OS=Arabidopsis thaliana GN=SYP123 PE=2 SV=1 43 279 2.0E-09
sp|Q8VZU2|SY132_ARATH Syntaxin-132 OS=Arabidopsis thaliana GN=SYP132 PE=1 SV=1 138 278 9.0E-09
sp|Q9D3G5|STX11_MOUSE Syntaxin-11 OS=Mus musculus GN=Stx11 PE=1 SV=1 51 282 7.0E-08
sp|Q7KVY7|STX4_DROME Syntaxin-4 OS=Drosophila melanogaster GN=Syx4 PE=2 SV=1 123 275 7.0E-08
sp|O94651|PEP12_SCHPO Syntaxin pep12 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pep12 PE=1 SV=2 205 291 2.0E-07
sp|Q42374|SY111_ARATH Syntaxin-related protein KNOLLE OS=Arabidopsis thaliana GN=KN PE=1 SV=1 43 278 1.0E-06
sp|Q9ZSD4|SY121_ARATH Syntaxin-121 OS=Arabidopsis thaliana GN=SYP121 PE=1 SV=1 38 278 1.0E-06
sp|Q20574|STX2_CAEEL Putative syntaxin-2 OS=Caenorhabditis elegans GN=syx-2 PE=3 SV=4 51 269 2.0E-06
sp|Q8R1Q0|STX19_MOUSE Syntaxin-19 OS=Mus musculus GN=Stx19 PE=2 SV=1 48 270 7.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0016020 membrane Yes
GO:0110165 cellular anatomical entity No
GO:0005575 cellular_component No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 54 0.45

Transmembrane Domains

Domain # Start End Length
1 277 299 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
SC16a Pure fungal culture 86.79 47.32 126.26
CcL In ants, during behavior modification 112.62 60.75 164.50
CcD In ants, recently dead 55.61 28.60 82.63

Differential expression

Label1 Label2 Q-value Significant difference
SC16a CcL 0.262626 no
SC16a CcD 0.055274 no
CcL CcD 0.001851 yes

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|6189
MSTGGGYGHGGYGQNNPYAEDQYEMTDYGSPDKPETHTTTVLNQQAFLDRVQSLRDDIRQLTSDVDRIGQLHHRC
LASADGMAKQQLEQAVIQTQIRNTAVKDGIKGLERDLARTADSSRATKRTQLQSLKSFFKSELDKYQAIERDYQN
RYREQIARQYRIVNPDASEDEVRQAAEADWGNEGVFQTALRTNRTGHATSLLGNVRARHNELQRIEQTLTEIAIL
YDELATLVEVQDPVIQSAEENAQHTVDNMEKGNEQVKQANEHARRRRKLKWWCLLIVVLIIIGIGLGVGLGLCLG
TNRCDKKS
Coding >Ophio5|6189
ATGTCGACGGGCGGCGGCTATGGCCACGGCGGCTACGGCCAGAATAACCCCTACGCCGAAGACCAGTACGAGATG
ACGGATTACGGCAGCCCCGACAAGCCAGAGACGCACACGACGACGGTGCTAAATCAGCAAGCCTTCCTCGACCGT
GTACAATCCTTGCGCGACGACATCAGACAACTGACGAGCGACGTCGACCGTATCGGCCAGCTGCATCATCGATGT
CTTGCCAGTGCCGATGGAATGGCCAAGCAGCAGCTCGAGCAGGCTGTTATTCAGACGCAGATACGCAACACGGCC
GTCAAGGATGGCATCAAGGGTCTTGAGCGCGATTTGGCGCGGACTGCAGACTCGTCGCGTGCCACGAAGCGGACG
CAACTGCAGTCGCTCAAGTCCTTTTTCAAGTCGGAGCTCGACAAGTATCAGGCCATTGAGCGCGATTATCAGAAT
CGGTATCGCGAGCAGATCGCTCGTCAGTACCGTATCGTCAACCCGGATGCCAGTGAGGACGAGGTGCGTCAGGCT
GCTGAGGCAGACTGGGGGAACGAGGGCGTCTTCCAGACGGCTTTACGCACCAACCGCACCGGTCACGCAACCTCG
CTTCTCGGCAACGTTCGCGCCCGTCACAATGAGCTGCAACGGATCGAGCAGACGCTCACCGAAATCGCCATCCTC
TATGACGAGCTCGCCACTCTCGTCGAAGTGCAAGATCCCGTCATTCAGTCGGCCGAGGAGAATGCGCAACACACC
GTCGATAACATGGAAAAGGGCAACGAACAGGTCAAGCAGGCAAATGAGCACGCCCGTCGCCGTCGGAAGCTCAAG
TGGTGGTGTCTCCTCATCGTCGTCCTCATCATCATTGGCATCGGCCTCGGCGTCGGCCTCGGTCTTTGCCTCGGT
ACGAATCGGTGCGACAAGAAGTCA
Transcript >Ophio5|6189
ATGTCGACGGGCGGCGGCTATGGCCACGGCGGCTACGGCCAGAATAACCCCTACGCCGAAGACCAGTACGAGATG
ACGGATTACGGCAGCCCCGACAAGCCAGAGACGCACACGACGACGGTGCTAAATCAGCAAGCCTTCCTCGACCGT
GTACAATCCTTGCGCGACGACATCAGACAACTGACGAGCGACGTCGACCGTATCGGCCAGCTGCATCATCGATGT
CTTGCCAGTGCCGATGGAATGGCCAAGCAGCAGCTCGAGCAGGCTGTTATTCAGACGCAGATACGCAACACGGCC
GTCAAGGATGGCATCAAGGGTCTTGAGCGCGATTTGGCGCGGACTGCAGACTCGTCGCGTGCCACGAAGCGGACG
CAACTGCAGTCGCTCAAGTCCTTTTTCAAGTCGGAGCTCGACAAGTATCAGGCCATTGAGCGCGATTATCAGAAT
CGGTATCGCGAGCAGATCGCTCGTCAGTACCGTATCGTCAACCCGGATGCCAGTGAGGACGAGGTGCGTCAGGCT
GCTGAGGCAGACTGGGGGAACGAGGGCGTCTTCCAGACGGCTTTACGCACCAACCGCACCGGTCACGCAACCTCG
CTTCTCGGCAACGTTCGCGCCCGTCACAATGAGCTGCAACGGATCGAGCAGACGCTCACCGAAATCGCCATCCTC
TATGACGAGCTCGCCACTCTCGTCGAAGTGCAAGATCCCGTCATTCAGTCGGCCGAGGAGAATGCGCAACACACC
GTCGATAACATGGAAAAGGGCAACGAACAGGTCAAGCAGGCAAATGAGCACGCCCGTCGCCGTCGGAAGCTCAAG
TGGTGGTGTCTCCTCATCGTCGTCCTCATCATCATTGGCATCGGCCTCGGCGTCGGCCTCGGTCTTTGCCTCGGT
ACGAATCGGTGCGACAAGAAGTCATAG
Gene >Ophio5|6189
ATGTCGACGGGCGGCGGCTATGGCCACGGCGGCTACGGCCAGAATAACCCCTACGCCGAAGACCAGTACGAGATG
ACGGATTACGGCAGCCCCGACAAGCCAGAGACGCACACGACGACGGTGCTAAATCAGCAAGCCTTCCTCGACCGT
GTACAATCCTTGCGCGACGACATCAGACAACTGACGAGCGACGTCGACCGTATCGGCCAGCTGCATCATCGATGT
CTTGCCAGTGCCGATGGAATGGCCAAGCAGCAGCTCGAGCAGGCTGTTATTCAGACGCAGATACGCAACACGGCC
GTCAAGGATGGCATCAAGGGTCTTGAGCGCGATTTGGCGCGGACTGCAGACTCGTCGCGTGCCACGAAGCGGACG
CAACTGCAGTCGCTCAAGTCCTTTTTCAAGTCGGAGCTCGACAAGTATCAGGCCATTGAGCGCGATTATCAGAAT
CGGTATCGCGAGCAGATCGCTCGTCAGTACCGTATCGTCAACCCGGATGCCAGTGAGGACGAGGTGCGTCAGGCT
GCTGAGGCAGACTGGGGGAACGAGGGCGTCTTCCAGACGGCTGTATGTCTTCTCTCTTTTTTTTTTTTTCCCAGT
CTCTTTGCTCCCTTTCTTTCGTCTTGGCTGAAGCGTCATAGTTACGCACCAACCGCACCGGTCACGCAACCTCGC
TTCTCGGCAACGTTCGCGCCCGTCACAATGAGCTGCAACGGATCGAGCAGACGCTCACCGAAATCGCCATCCTCT
ATGACGAGCTCGCCACTCTCGTCGAAGTGCAAGATCCCGTCATTCAGTCGGCCGAGGAGAATGCGCAACACACCG
TCGATAACATGGAAAAGGGCAACGAACAGGTCAAGCAGGCAAATGAGCACGCCCGTCGCCGTCGGAAGCTCAAGT
GGTGGTGTCTCCTCATCGTCGTCCTCATCATCATTGGCATCGGCCTCGGCGTCGGCCTCGGTCTTTGCCTCGGTA
CGAATCGGTGCGACAAGAAGTCATAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail