Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|6189
Gene name
Locationscaffold_53:16961..17962
Strand-
Gene length (bp)1001
Transcript length (bp)927
Coding sequence length (bp)924
Protein length (aa) 308

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00804 Syntaxin Syntaxin 7.0E-27 47 236
PF05739 SNARE SNARE domain 2.1E-13 239 289

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9USH7|PSY1_SCHPO Syntaxin-like protein psy1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=psy1 PE=3 SV=1 47 279 4.0E-35
sp|Q59YF0|SSO2_CANAL Protein transport protein SSO2 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=SSO2 PE=3 SV=1 1 303 2.0E-26
sp|P39926|SSO2_YEAST Protein SSO2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SSO2 PE=1 SV=2 12 286 1.0E-24
sp|P32867|SSO1_YEAST Protein SSO1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SSO1 PE=1 SV=2 15 280 1.0E-23
sp|P61268|STX1B_SHEEP Syntaxin-1B OS=Ovis aries GN=STX1B PE=2 SV=1 47 300 6.0E-22
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9USH7|PSY1_SCHPO Syntaxin-like protein psy1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=psy1 PE=3 SV=1 47 279 4.0E-35
sp|Q59YF0|SSO2_CANAL Protein transport protein SSO2 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=SSO2 PE=3 SV=1 1 303 2.0E-26
sp|P39926|SSO2_YEAST Protein SSO2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SSO2 PE=1 SV=2 12 286 1.0E-24
sp|P32867|SSO1_YEAST Protein SSO1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SSO1 PE=1 SV=2 15 280 1.0E-23
sp|P61268|STX1B_SHEEP Syntaxin-1B OS=Ovis aries GN=STX1B PE=2 SV=1 47 300 6.0E-22
sp|P61267|STX1B_BOVIN Syntaxin-1B OS=Bos taurus GN=STX1B PE=1 SV=1 47 300 6.0E-22
sp|P61265|STX1B_RAT Syntaxin-1B OS=Rattus norvegicus GN=Stx1b PE=1 SV=1 47 300 3.0E-21
sp|P61264|STX1B_MOUSE Syntaxin-1B OS=Mus musculus GN=Stx1b PE=1 SV=1 47 300 3.0E-21
sp|P61266|STX1B_HUMAN Syntaxin-1B OS=Homo sapiens GN=STX1B PE=1 SV=1 47 300 3.0E-21
sp|P32850|STX1A_BOVIN Syntaxin-1A OS=Bos taurus GN=STX1A PE=1 SV=1 47 300 2.0E-19
sp|P32851|STX1A_RAT Syntaxin-1A OS=Rattus norvegicus GN=Stx1a PE=1 SV=1 47 300 2.0E-19
sp|O35526|STX1A_MOUSE Syntaxin-1A OS=Mus musculus GN=Stx1a PE=1 SV=3 47 300 3.0E-19
sp|Q16623|STX1A_HUMAN Syntaxin-1A OS=Homo sapiens GN=STX1A PE=1 SV=1 47 296 8.0E-19
sp|Q16932|STX_APLCA Syntaxin OS=Aplysia californica PE=2 SV=1 45 279 1.0E-18
sp|Q5R4L2|STX1A_PONAB Syntaxin-1A OS=Pongo abelii GN=STX1A PE=2 SV=1 47 296 2.0E-18
sp|P32856|STX2_HUMAN Syntaxin-2 OS=Homo sapiens GN=STX2 PE=2 SV=3 38 297 4.0E-18
sp|Q08850|STX4_RAT Syntaxin-4 OS=Rattus norvegicus GN=Stx4 PE=1 SV=1 47 294 2.0E-16
sp|P70452|STX4_MOUSE Syntaxin-4 OS=Mus musculus GN=Stx4 PE=1 SV=1 28 294 4.0E-16
sp|O16000|STX1A_CAEEL Syntaxin-1A homolog OS=Caenorhabditis elegans GN=unc-64 PE=1 SV=1 45 293 7.0E-16
sp|Q24547|STX1A_DROME Syntaxin-1A OS=Drosophila melanogaster GN=Syx1A PE=1 SV=1 47 289 3.0E-15
sp|Q13277|STX3_HUMAN Syntaxin-3 OS=Homo sapiens GN=STX3 PE=1 SV=3 47 300 9.0E-15
sp|Q64704|STX3_MOUSE Syntaxin-3 OS=Mus musculus GN=Stx3 PE=1 SV=1 47 273 2.0E-14
sp|Q08849|STX3_RAT Syntaxin-3 OS=Rattus norvegicus GN=Stx3 PE=2 SV=1 47 273 2.0E-14
sp|Q12846|STX4_HUMAN Syntaxin-4 OS=Homo sapiens GN=STX4 PE=1 SV=2 28 293 7.0E-14
sp|A8WVD0|STX1A_CAEBR Syntaxin-1A OS=Caenorhabditis briggsae GN=unc-64 PE=3 SV=1 45 275 8.0E-13
sp|Q00262|STX2_MOUSE Syntaxin-2 OS=Mus musculus GN=Stx2 PE=1 SV=1 47 276 2.0E-12
sp|P50279|STX2_RAT Syntaxin-2 OS=Rattus norvegicus GN=Stx2 PE=1 SV=2 46 276 2.0E-12
sp|Q9SRV7|SY131_ARATH Putative syntaxin-131 OS=Arabidopsis thaliana GN=SYP131 PE=3 SV=1 5 278 3.0E-12
sp|Q3SWZ3|STX4_BOVIN Syntaxin-4 OS=Bos taurus GN=STX4 PE=2 SV=1 29 281 3.0E-11
sp|Q20024|STX3_CAEEL Putative syntaxin-3 OS=Caenorhabditis elegans GN=syx-3 PE=3 SV=3 27 304 7.0E-11
sp|O64791|SY124_ARATH Syntaxin-124 OS=Arabidopsis thaliana GN=SYP124 PE=2 SV=1 42 287 1.0E-10
sp|Q9SXB0|SY125_ARATH Syntaxin-125 OS=Arabidopsis thaliana GN=SYP125 PE=2 SV=1 42 278 3.0E-10
sp|O75558|STX11_HUMAN Syntaxin-11 OS=Homo sapiens GN=STX11 PE=1 SV=1 12 278 3.0E-10
sp|Q9ZQZ8|SY123_ARATH Syntaxin-123 OS=Arabidopsis thaliana GN=SYP123 PE=2 SV=1 43 279 2.0E-09
sp|Q8VZU2|SY132_ARATH Syntaxin-132 OS=Arabidopsis thaliana GN=SYP132 PE=1 SV=1 138 278 9.0E-09
sp|Q9D3G5|STX11_MOUSE Syntaxin-11 OS=Mus musculus GN=Stx11 PE=1 SV=1 51 282 7.0E-08
sp|Q7KVY7|STX4_DROME Syntaxin-4 OS=Drosophila melanogaster GN=Syx4 PE=2 SV=1 123 275 7.0E-08
sp|O94651|PEP12_SCHPO Syntaxin pep12 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pep12 PE=1 SV=2 205 291 2.0E-07
sp|Q42374|SY111_ARATH Syntaxin-related protein KNOLLE OS=Arabidopsis thaliana GN=KN PE=1 SV=1 43 278 1.0E-06
sp|Q9ZSD4|SY121_ARATH Syntaxin-121 OS=Arabidopsis thaliana GN=SYP121 PE=1 SV=1 38 278 1.0E-06
sp|Q20574|STX2_CAEEL Putative syntaxin-2 OS=Caenorhabditis elegans GN=syx-2 PE=3 SV=4 51 269 2.0E-06
sp|Q8R1Q0|STX19_MOUSE Syntaxin-19 OS=Mus musculus GN=Stx19 PE=2 SV=1 48 270 7.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0016020 membrane Yes
GO:0110165 cellular anatomical entity No
GO:0005575 cellular_component No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 54 0.45

Transmembrane Domains

Domain # Start End Length
1 277 299 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|6189
MSTGGGYGHGGYGQNNPYAEDQYEMTDYGSPDKPETHTTTVLNQQAFLDRVQSLRDDIRQLTSDVDRIGQLHHRC
LASADGMAKQQLEQAVIQTQIRNTAVKDGIKGLERDLARTADSSRATKRTQLQSLKSFFKSELDKYQAIERDYQN
RYREQIARQYRIVNPDASEDEVRQAAEADWGNEGVFQTALRTNRTGHATSLLGNVRARHNELQRIEQTLTEIAIL
YDELATLVEVQDPVIQSAEENAQHTVDNMEKGNEQVKQANEHARRRRKLKWWCLLIVVLIIIGIGLGVGLGLCLG
TNRCDKKS
Coding >Ophio5|6189
ATGTCGACGGGCGGCGGCTATGGCCACGGCGGCTACGGCCAGAATAACCCCTACGCCGAAGACCAGTACGAGATG
ACGGATTACGGCAGCCCCGACAAGCCAGAGACGCACACGACGACGGTGCTAAATCAGCAAGCCTTCCTCGACCGT
GTACAATCCTTGCGCGACGACATCAGACAACTGACGAGCGACGTCGACCGTATCGGCCAGCTGCATCATCGATGT
CTTGCCAGTGCCGATGGAATGGCCAAGCAGCAGCTCGAGCAGGCTGTTATTCAGACGCAGATACGCAACACGGCC
GTCAAGGATGGCATCAAGGGTCTTGAGCGCGATTTGGCGCGGACTGCAGACTCGTCGCGTGCCACGAAGCGGACG
CAACTGCAGTCGCTCAAGTCCTTTTTCAAGTCGGAGCTCGACAAGTATCAGGCCATTGAGCGCGATTATCAGAAT
CGGTATCGCGAGCAGATCGCTCGTCAGTACCGTATCGTCAACCCGGATGCCAGTGAGGACGAGGTGCGTCAGGCT
GCTGAGGCAGACTGGGGGAACGAGGGCGTCTTCCAGACGGCTTTACGCACCAACCGCACCGGTCACGCAACCTCG
CTTCTCGGCAACGTTCGCGCCCGTCACAATGAGCTGCAACGGATCGAGCAGACGCTCACCGAAATCGCCATCCTC
TATGACGAGCTCGCCACTCTCGTCGAAGTGCAAGATCCCGTCATTCAGTCGGCCGAGGAGAATGCGCAACACACC
GTCGATAACATGGAAAAGGGCAACGAACAGGTCAAGCAGGCAAATGAGCACGCCCGTCGCCGTCGGAAGCTCAAG
TGGTGGTGTCTCCTCATCGTCGTCCTCATCATCATTGGCATCGGCCTCGGCGTCGGCCTCGGTCTTTGCCTCGGT
ACGAATCGGTGCGACAAGAAGTCA
Transcript >Ophio5|6189
ATGTCGACGGGCGGCGGCTATGGCCACGGCGGCTACGGCCAGAATAACCCCTACGCCGAAGACCAGTACGAGATG
ACGGATTACGGCAGCCCCGACAAGCCAGAGACGCACACGACGACGGTGCTAAATCAGCAAGCCTTCCTCGACCGT
GTACAATCCTTGCGCGACGACATCAGACAACTGACGAGCGACGTCGACCGTATCGGCCAGCTGCATCATCGATGT
CTTGCCAGTGCCGATGGAATGGCCAAGCAGCAGCTCGAGCAGGCTGTTATTCAGACGCAGATACGCAACACGGCC
GTCAAGGATGGCATCAAGGGTCTTGAGCGCGATTTGGCGCGGACTGCAGACTCGTCGCGTGCCACGAAGCGGACG
CAACTGCAGTCGCTCAAGTCCTTTTTCAAGTCGGAGCTCGACAAGTATCAGGCCATTGAGCGCGATTATCAGAAT
CGGTATCGCGAGCAGATCGCTCGTCAGTACCGTATCGTCAACCCGGATGCCAGTGAGGACGAGGTGCGTCAGGCT
GCTGAGGCAGACTGGGGGAACGAGGGCGTCTTCCAGACGGCTTTACGCACCAACCGCACCGGTCACGCAACCTCG
CTTCTCGGCAACGTTCGCGCCCGTCACAATGAGCTGCAACGGATCGAGCAGACGCTCACCGAAATCGCCATCCTC
TATGACGAGCTCGCCACTCTCGTCGAAGTGCAAGATCCCGTCATTCAGTCGGCCGAGGAGAATGCGCAACACACC
GTCGATAACATGGAAAAGGGCAACGAACAGGTCAAGCAGGCAAATGAGCACGCCCGTCGCCGTCGGAAGCTCAAG
TGGTGGTGTCTCCTCATCGTCGTCCTCATCATCATTGGCATCGGCCTCGGCGTCGGCCTCGGTCTTTGCCTCGGT
ACGAATCGGTGCGACAAGAAGTCATAG
Gene >Ophio5|6189
ATGTCGACGGGCGGCGGCTATGGCCACGGCGGCTACGGCCAGAATAACCCCTACGCCGAAGACCAGTACGAGATG
ACGGATTACGGCAGCCCCGACAAGCCAGAGACGCACACGACGACGGTGCTAAATCAGCAAGCCTTCCTCGACCGT
GTACAATCCTTGCGCGACGACATCAGACAACTGACGAGCGACGTCGACCGTATCGGCCAGCTGCATCATCGATGT
CTTGCCAGTGCCGATGGAATGGCCAAGCAGCAGCTCGAGCAGGCTGTTATTCAGACGCAGATACGCAACACGGCC
GTCAAGGATGGCATCAAGGGTCTTGAGCGCGATTTGGCGCGGACTGCAGACTCGTCGCGTGCCACGAAGCGGACG
CAACTGCAGTCGCTCAAGTCCTTTTTCAAGTCGGAGCTCGACAAGTATCAGGCCATTGAGCGCGATTATCAGAAT
CGGTATCGCGAGCAGATCGCTCGTCAGTACCGTATCGTCAACCCGGATGCCAGTGAGGACGAGGTGCGTCAGGCT
GCTGAGGCAGACTGGGGGAACGAGGGCGTCTTCCAGACGGCTGTATGTCTTCTCTCTTTTTTTTTTTTTCCCAGT
CTCTTTGCTCCCTTTCTTTCGTCTTGGCTGAAGCGTCATAGTTACGCACCAACCGCACCGGTCACGCAACCTCGC
TTCTCGGCAACGTTCGCGCCCGTCACAATGAGCTGCAACGGATCGAGCAGACGCTCACCGAAATCGCCATCCTCT
ATGACGAGCTCGCCACTCTCGTCGAAGTGCAAGATCCCGTCATTCAGTCGGCCGAGGAGAATGCGCAACACACCG
TCGATAACATGGAAAAGGGCAACGAACAGGTCAAGCAGGCAAATGAGCACGCCCGTCGCCGTCGGAAGCTCAAGT
GGTGGTGTCTCCTCATCGTCGTCCTCATCATCATTGGCATCGGCCTCGGCGTCGGCCTCGGTCTTTGCCTCGGTA
CGAATCGGTGCGACAAGAAGTCATAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail