Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|6174
Gene name
Locationscaffold_528:12054..14077
Strand-
Gene length (bp)2023
Transcript length (bp)1974
Coding sequence length (bp)1971
Protein length (aa) 657

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF03999 MAP65_ASE1 Microtubule associated protein (MAP65/ASE1 family) 2.6E-66 6 466

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q9HDY1|ASE1_SCHPO Anaphase spindle elongation protein 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ase1 PE=1 SV=1 3 569 3.0E-59
sp|O43663|PRC1_HUMAN Protein regulator of cytokinesis 1 OS=Homo sapiens GN=PRC1 PE=1 SV=2 167 401 5.0E-23
sp|Q99K43|PRC1_MOUSE Protein regulator of cytokinesis 1 OS=Mus musculus GN=Prc1 PE=1 SV=2 167 482 1.0E-22
sp|P50275|ASE1_YEAST Anaphase spindle elongation protein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ASE1 PE=1 SV=1 116 395 4.0E-20

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm|Nucleus Nuclear localization signal 0.762 0.5655 0.0994 0.0801 0.137 0.004 0.0292 0.1062 0.0793 0.0112

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup3501
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|7545
Ophiocordyceps australis map64 (Brazil) OphauB2|1414
Ophiocordyceps camponoti-floridani Ophcf2|06003
Ophiocordyceps camponoti-rufipedis Ophun1|412
Ophiocordyceps kimflemingae Ophio5|6174 (this protein)
Ophiocordyceps subramaniannii Hirsu2|6692

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|6174
MMDQAKQTITAIRQMEASLDGSRPASSRSMDPDDDLAITYPLTRCLQTLRDKHMHISRLHRDRFEQVKKLVDALV
SYSSHLEPSFVQIALPPTGPGQSVPSSFDLSPAYVDRLDAEFTRVYDEYTRRIASVQTLADHIIQLWAELGIPQA
QQDGAIVKYYRDAPEQLGLHDEDLSRLQAKRDRLAEEKKNRERRLRELRAAVETLWEKLGVDEAETRAFLSQNRG
CGVRQINEFEDELARLDELKGQNLHLFVEDARVQLQDLWDALYLSEDEMLEFTPAFSDVYSDALLEAHEREVARL
EALREQRAPLLALVDRHKALLRDRDELAASSQDASRLMMRGSNNKGERRDPGKLLREEKTRKRVAKELPKATAEV
RRALAKWEDEYGRPFLVFGERYLDEVEADEAKRPASTTGRSKTPAASSRPKSAELSRGNSVRARPMSAELSRANS
VRSAALPSRSMTKTPTGRKTGNTQQQQTASPSRLPARVPLSNLKHGANSPDRNRPTCRAAATETLRNGAPLRAPP
PKMRILGSVPELSASGNSNIVRHVEPEDVYDDSRSRTTTSEYASSRHTSHTSSTAISGSENWETYVDDDDDSDPE
PDASEAYYAKVRAARRFESRRPVARGMPPHGEPVVLDQDGNRIVSGGGEWTDEDALF
Coding >Ophio5|6174
ATGATGGATCAGGCCAAGCAGACCATCACCGCTATCCGCCAGATGGAGGCATCGCTCGATGGCTCTAGACCGGCA
AGCAGCAGGTCCATGGATCCGGATGACGACTTGGCCATTACTTATCCCCTGACGCGCTGTTTGCAGACGCTCCGC
GACAAGCACATGCACATCAGTCGCCTGCACAGGGATCGCTTCGAGCAAGTCAAGAAGCTCGTCGACGCCCTCGTC
TCCTACTCGTCGCATCTCGAGCCCTCGTTCGTCCAGATCGCGCTCCCGCCCACGGGGCCGGGCCAGTCCGTGCCG
TCATCGTTTGACCTGTCGCCCGCCTACGTCGACCGGCTGGACGCCGAGTTTACGCGCGTCTACGACGAATACACG
CGTCGCATAGCTTCTGTCCAGACGCTGGCGGACCACATCATCCAGCTGTGGGCCGAGCTCGGCATCCCCCAGGCT
CAGCAGGACGGCGCCATCGTCAAATACTATCGCGACGCCCCCGAGCAGCTGGGCTTGCACGACGAGGACCTTTCC
CGGCTGCAGGCCAAGCGCGACCGTCTCGCCGAGGAGAAGAAGAATCGCGAGCGCAGACTACGTGAGCTGCGTGCA
GCCGTCGAGACGCTGTGGGAAAAGCTCGGCGTCGACGAGGCAGAAACCAGGGCCTTTCTCAGCCAGAATCGCGGC
TGCGGCGTGCGACAGATTAACGAATTCGAGGACGAGCTTGCGCGTCTCGACGAGCTGAAAGGGCAGAACCTCCAC
CTCTTCGTCGAGGACGCGCGCGTGCAGCTACAAGACCTCTGGGACGCCCTCTACCTTTCCGAAGACGAGATGCTC
GAGTTCACGCCCGCCTTCTCCGACGTCTATAGCGACGCCCTGCTCGAAGCCCACGAGCGAGAGGTGGCGCGTCTC
GAAGCGCTACGCGAGCAACGGGCGCCTTTGCTAGCCCTCGTCGACCGGCACAAGGCTTTGTTACGAGACCGCGAC
GAGCTGGCGGCTTCGAGCCAAGACGCCTCGCGGCTGATGATGCGCGGCAGCAACAACAAGGGCGAGCGCCGAGAC
CCGGGTAAGCTGCTGCGCGAGGAGAAGACGCGCAAGAGAGTGGCCAAGGAGCTGCCCAAGGCGACGGCCGAGGTG
AGACGCGCGCTGGCCAAGTGGGAGGACGAGTATGGCCGGCCTTTCTTGGTCTTTGGCGAGAGATACCTGGATGAA
GTGGAGGCGGATGAGGCGAAACGACCGGCTTCGACGACAGGGCGATCCAAGACTCCCGCTGCTTCGTCTCGGCCC
AAGTCGGCGGAGCTGAGCAGAGGGAACAGTGTCCGAGCACGGCCCATGTCGGCTGAGTTGAGCAGGGCAAACAGT
GTGCGGTCTGCGGCATTGCCGTCGCGCTCCATGACCAAGACGCCGACGGGCAGAAAGACGGGCAACACGCAGCAG
CAGCAGACGGCCAGTCCCTCCAGACTCCCGGCGCGGGTGCCTCTATCGAATCTCAAGCACGGCGCCAATTCTCCG
GACCGGAATCGGCCGACATGCCGGGCGGCGGCGACGGAGACGCTTCGCAACGGCGCGCCTCTACGAGCGCCACCT
CCCAAGATGCGCATCCTAGGCTCCGTCCCGGAACTCTCAGCTTCGGGAAACAGTAACATTGTGCGACACGTCGAG
CCGGAAGACGTCTACGATGACAGCCGGAGCAGGACGACGACGAGCGAATACGCCAGCTCGAGACATACATCCCAC
ACGTCCTCTACCGCCATCTCGGGCTCCGAGAACTGGGAGACGTACGTCGACGACGACGACGACAGTGATCCGGAG
CCGGACGCGTCAGAGGCCTACTATGCCAAGGTCCGAGCCGCCAGACGGTTCGAGTCACGGCGTCCGGTCGCCCGC
GGGATGCCGCCTCATGGTGAGCCTGTCGTGCTGGACCAGGATGGGAACCGCATCGTGTCGGGAGGGGGAGAGTGG
ACGGACGAGGATGCTTTGTTT
Transcript >Ophio5|6174
ATGATGGATCAGGCCAAGCAGACCATCACCGCTATCCGCCAGATGGAGGCATCGCTCGATGGCTCTAGACCGGCA
AGCAGCAGGTCCATGGATCCGGATGACGACTTGGCCATTACTTATCCCCTGACGCGCTGTTTGCAGACGCTCCGC
GACAAGCACATGCACATCAGTCGCCTGCACAGGGATCGCTTCGAGCAAGTCAAGAAGCTCGTCGACGCCCTCGTC
TCCTACTCGTCGCATCTCGAGCCCTCGTTCGTCCAGATCGCGCTCCCGCCCACGGGGCCGGGCCAGTCCGTGCCG
TCATCGTTTGACCTGTCGCCCGCCTACGTCGACCGGCTGGACGCCGAGTTTACGCGCGTCTACGACGAATACACG
CGTCGCATAGCTTCTGTCCAGACGCTGGCGGACCACATCATCCAGCTGTGGGCCGAGCTCGGCATCCCCCAGGCT
CAGCAGGACGGCGCCATCGTCAAATACTATCGCGACGCCCCCGAGCAGCTGGGCTTGCACGACGAGGACCTTTCC
CGGCTGCAGGCCAAGCGCGACCGTCTCGCCGAGGAGAAGAAGAATCGCGAGCGCAGACTACGTGAGCTGCGTGCA
GCCGTCGAGACGCTGTGGGAAAAGCTCGGCGTCGACGAGGCAGAAACCAGGGCCTTTCTCAGCCAGAATCGCGGC
TGCGGCGTGCGACAGATTAACGAATTCGAGGACGAGCTTGCGCGTCTCGACGAGCTGAAAGGGCAGAACCTCCAC
CTCTTCGTCGAGGACGCGCGCGTGCAGCTACAAGACCTCTGGGACGCCCTCTACCTTTCCGAAGACGAGATGCTC
GAGTTCACGCCCGCCTTCTCCGACGTCTATAGCGACGCCCTGCTCGAAGCCCACGAGCGAGAGGTGGCGCGTCTC
GAAGCGCTACGCGAGCAACGGGCGCCTTTGCTAGCCCTCGTCGACCGGCACAAGGCTTTGTTACGAGACCGCGAC
GAGCTGGCGGCTTCGAGCCAAGACGCCTCGCGGCTGATGATGCGCGGCAGCAACAACAAGGGCGAGCGCCGAGAC
CCGGGTAAGCTGCTGCGCGAGGAGAAGACGCGCAAGAGAGTGGCCAAGGAGCTGCCCAAGGCGACGGCCGAGGTG
AGACGCGCGCTGGCCAAGTGGGAGGACGAGTATGGCCGGCCTTTCTTGGTCTTTGGCGAGAGATACCTGGATGAA
GTGGAGGCGGATGAGGCGAAACGACCGGCTTCGACGACAGGGCGATCCAAGACTCCCGCTGCTTCGTCTCGGCCC
AAGTCGGCGGAGCTGAGCAGAGGGAACAGTGTCCGAGCACGGCCCATGTCGGCTGAGTTGAGCAGGGCAAACAGT
GTGCGGTCTGCGGCATTGCCGTCGCGCTCCATGACCAAGACGCCGACGGGCAGAAAGACGGGCAACACGCAGCAG
CAGCAGACGGCCAGTCCCTCCAGACTCCCGGCGCGGGTGCCTCTATCGAATCTCAAGCACGGCGCCAATTCTCCG
GACCGGAATCGGCCGACATGCCGGGCGGCGGCGACGGAGACGCTTCGCAACGGCGCGCCTCTACGAGCGCCACCT
CCCAAGATGCGCATCCTAGGCTCCGTCCCGGAACTCTCAGCTTCGGGAAACAGTAACATTGTGCGACACGTCGAG
CCGGAAGACGTCTACGATGACAGCCGGAGCAGGACGACGACGAGCGAATACGCCAGCTCGAGACATACATCCCAC
ACGTCCTCTACCGCCATCTCGGGCTCCGAGAACTGGGAGACGTACGTCGACGACGACGACGACAGTGATCCGGAG
CCGGACGCGTCAGAGGCCTACTATGCCAAGGTCCGAGCCGCCAGACGGTTCGAGTCACGGCGTCCGGTCGCCCGC
GGGATGCCGCCTCATGGTGAGCCTGTCGTGCTGGACCAGGATGGGAACCGCATCGTGTCGGGAGGGGGAGAGTGG
ACGGACGAGGATGCTTTGTTTTGA
Gene >Ophio5|6174
ATGATGGATCAGGCCAAGCAGACCATCACCGCTATCCGCCAGATGGAGGCATCGCTCGATGGCTCTAGACCGGCA
AGCAGCAGGTCCATGGATCCGGATGACGACTTGGCCATTACTTATCCCCTGACGCGCTGTTTGCAGACGCTCCGC
GACAAGCACATGCACATCAGTCGCCTGCACAGGGATCGCTTCGAGCAAGTCAAGAGTGAGTTCGAGGTCCCCAAG
TAGGTGATGCGCAGGCTGACACGACGCAGAGCTCGTCGACGCCCTCGTCTCCTACTCGTCGCATCTCGAGCCCTC
GTTCGTCCAGATCGCGCTCCCGCCCACGGGGCCGGGCCAGTCCGTGCCGTCATCGTTTGACCTGTCGCCCGCCTA
CGTCGACCGGCTGGACGCCGAGTTTACGCGCGTCTACGACGAATACACGCGTCGCATAGCTTCTGTCCAGACGCT
GGCGGACCACATCATCCAGCTGTGGGCCGAGCTCGGCATCCCCCAGGCTCAGCAGGACGGCGCCATCGTCAAATA
CTATCGCGACGCCCCCGAGCAGCTGGGCTTGCACGACGAGGACCTTTCCCGGCTGCAGGCCAAGCGCGACCGTCT
CGCCGAGGAGAAGAAGAATCGCGAGCGCAGACTACGTGAGCTGCGTGCAGCCGTCGAGACGCTGTGGGAAAAGCT
CGGCGTCGACGAGGCAGAAACCAGGGCCTTTCTCAGCCAGAATCGCGGCTGCGGCGTGCGACAGATTAACGAATT
CGAGGACGAGCTTGCGCGTCTCGACGAGCTGAAAGGGCAGAACCTCCACCTCTTCGTCGAGGACGCGCGCGTGCA
GCTACAAGACCTCTGGGACGCCCTCTACCTTTCCGAAGACGAGATGCTCGAGTTCACGCCCGCCTTCTCCGACGT
CTATAGCGACGCCCTGCTCGAAGCCCACGAGCGAGAGGTGGCGCGTCTCGAAGCGCTACGCGAGCAACGGGCGCC
TTTGCTAGCCCTCGTCGACCGGCACAAGGCTTTGTTACGAGACCGCGACGAGCTGGCGGCTTCGAGCCAAGACGC
CTCGCGGCTGATGATGCGCGGCAGCAACAACAAGGGCGAGCGCCGAGACCCGGGTAAGCTGCTGCGCGAGGAGAA
GACGCGCAAGAGAGTGGCCAAGGAGCTGCCCAAGGCGACGGCCGAGGTGAGACGCGCGCTGGCCAAGTGGGAGGA
CGAGTATGGCCGGCCTTTCTTGGTCTTTGGCGAGAGATACCTGGATGAAGTGGAGGCGGATGAGGCGAAACGACC
GGCTTCGACGACAGGGCGATCCAAGACTCCCGCTGCTTCGTCTCGGCCCAAGTCGGCGGAGCTGAGCAGAGGGAA
CAGTGTCCGAGCACGGCCCATGTCGGCTGAGTTGAGCAGGGCAAACAGTGTGCGGTCTGCGGCATTGCCGTCGCG
CTCCATGACCAAGACGCCGACGGGCAGAAAGACGGGCAACACGCAGCAGCAGCAGACGGCCAGTCCCTCCAGACT
CCCGGCGCGGGTGCCTCTATCGAATCTCAAGCACGGCGCCAATTCTCCGGACCGGAATCGGCCGACATGCCGGGC
GGCGGCGACGGAGACGCTTCGCAACGGCGCGCCTCTACGAGCGCCACCTCCCAAGATGCGCATCCTAGGCTCCGT
CCCGGAACTCTCAGCTTCGGGAAACAGTAACATTGTGCGACACGTCGAGCCGGAAGACGTCTACGATGACAGCCG
GAGCAGGACGACGACGAGCGAATACGCCAGCTCGAGACATACATCCCACACGTCCTCTACCGCCATCTCGGGCTC
CGAGAACTGGGAGACGTACGTCGACGACGACGACGACAGTGATCCGGAGCCGGACGCGTCAGAGGCCTACTATGC
CAAGGTCCGAGCCGCCAGACGGTTCGAGTCACGGCGTCCGGTCGCCCGCGGGATGCCGCCTCATGGTGAGCCTGT
CGTGCTGGACCAGGATGGGAACCGCATCGTGTCGGGAGGGGGAGAGTGGACGGACGAGGATGCTTTGTTTTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail