Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|6172
Gene name
Locationscaffold_528:8160..9648
Strand-
Gene length (bp)1488
Transcript length (bp)1488
Coding sequence length (bp)1485
Protein length (aa) 495

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF08546 ApbA_C Ketopantoate reductase PanE/ApbA C terminal 9.8E-22 331 467
PF02558 ApbA Ketopantoate reductase PanE/ApbA 4.1E-16 91 222

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q9HDU6|PANE_SCHPO Probable 2-dehydropantoate 2-reductase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBPB2B2.09c PE=3 SV=1 91 468 2.0E-16

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 16 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|6172
MARPVLLRLHSTTSSSPVRFFHSTSAPPRSSSSSSSSNNKSATTKKPGWLTALMDASPGVGPQLYAWNASNVETC
TTPVPPPSTTESRGRIYIVGGGNIGRLFAICLARLSLPITLVVKRTTQLADYASHGIHLVKPSSSSSSSSSSSSS
SSSSCSTGSTTAPVSVEYWSETPPDHGPVRTVEPIRNLIVATKASAAVPAIDRLRRYLGRESVVVLAHNGLCRLW
HPDGALYKALRWPPAADGPLFMAAVLSHGLWATDSRTSIHAAVGRVLFGSLCAADADASAASDSDLASSPRRPHS
SRLASGPDPHLTRSLLSAPSLHAELLPPSELWLSQLEKMVYNSTINPLTSLLRCPNNELLSSPTRSRIVNRLLSE
TSRILTTLIALRAPVPLPPRFSPSDFAADSLRAKLDTFIPAVGPNHSSMLQHLRAGVQTEVRDFNGWLVETAADL
VPGFDPRTHRILVELVEAAKADDAPWTDHQLGRLLLSSSPSSSLP
Coding >Ophio5|6172
ATGGCACGACCAGTACTGCTACGGCTGCACAGCACGACAAGTTCGTCCCCAGTTCGTTTTTTCCATTCGACCTCG
GCTCCTCCTCGCAGCAGCAGCAGCAGCAGCAGCAGCAACAACAAGTCGGCCACGACGAAGAAGCCCGGCTGGCTC
ACGGCGCTCATGGACGCATCTCCCGGTGTAGGACCGCAGCTGTACGCCTGGAACGCAAGTAACGTCGAGACATGC
ACGACGCCGGTTCCGCCTCCTTCGACGACCGAGAGTAGAGGACGAATCTACATCGTGGGCGGCGGTAATATCGGA
CGCCTGTTCGCCATCTGTCTCGCTAGGCTATCCCTTCCCATCACCCTGGTGGTGAAGCGCACGACGCAGCTAGCA
GACTACGCCTCCCACGGCATCCATCTCGTCAAGCCCTCTTCCTCCTCTTCCTCTTCCTCCTCCTCCTCGTCCTCC
TCGTCCTCCTCTTGCAGCACAGGGTCGACCACGGCCCCGGTCTCGGTAGAGTACTGGTCAGAAACGCCGCCCGAC
CACGGCCCCGTCCGTACCGTAGAACCGATACGGAACCTCATCGTCGCCACCAAGGCTTCCGCCGCCGTGCCGGCT
ATAGATAGATTGCGGCGCTACCTCGGACGGGAGTCGGTCGTCGTCTTGGCTCATAATGGCCTCTGTCGACTTTGG
CACCCAGACGGCGCCCTGTACAAGGCTTTGCGCTGGCCGCCCGCTGCTGACGGCCCGCTCTTTATGGCTGCTGTG
CTTTCGCATGGCTTGTGGGCGACGGATTCGCGGACCAGTATCCATGCTGCCGTCGGACGGGTACTCTTTGGTTCC
CTTTGTGCTGCTGATGCTGATGCTTCCGCCGCCTCCGACTCGGATCTTGCCTCCTCCCCCCGTCGTCCGCACTCT
TCCCGTCTTGCCTCCGGCCCGGATCCCCATCTCACCCGCTCACTGCTCTCCGCCCCCTCTCTTCACGCCGAACTC
CTCCCCCCCTCGGAGCTATGGCTAAGCCAGCTAGAGAAGATGGTGTACAATAGCACCATCAACCCGCTAACCTCC
CTCCTGCGCTGCCCCAACAACGAGCTCCTCTCGTCCCCGACCAGGTCCCGAATCGTGAACCGCCTCCTGTCGGAA
ACGAGCCGCATCCTCACCACCCTCATCGCCCTCCGCGCCCCCGTTCCCCTTCCCCCCCGTTTCTCCCCTTCCGAC
TTCGCTGCCGATAGCCTTCGTGCTAAACTCGACACCTTCATCCCCGCTGTCGGCCCTAATCATAGCTCCATGTTG
CAGCATCTTCGTGCCGGCGTCCAGACCGAGGTTCGCGACTTTAATGGCTGGCTGGTCGAGACCGCTGCTGACCTG
GTCCCCGGCTTTGATCCCCGCACCCATCGCATCCTCGTCGAGCTGGTCGAGGCCGCTAAAGCGGACGATGCGCCT
TGGACCGATCACCAACTCGGCCGTCTCTTGCTTTCTTCATCACCTTCTTCCTCTCTACCT
Transcript >Ophio5|6172
ATGGCACGACCAGTACTGCTACGGCTGCACAGCACGACAAGTTCGTCCCCAGTTCGTTTTTTCCATTCGACCTCG
GCTCCTCCTCGCAGCAGCAGCAGCAGCAGCAGCAGCAACAACAAGTCGGCCACGACGAAGAAGCCCGGCTGGCTC
ACGGCGCTCATGGACGCATCTCCCGGTGTAGGACCGCAGCTGTACGCCTGGAACGCAAGTAACGTCGAGACATGC
ACGACGCCGGTTCCGCCTCCTTCGACGACCGAGAGTAGAGGACGAATCTACATCGTGGGCGGCGGTAATATCGGA
CGCCTGTTCGCCATCTGTCTCGCTAGGCTATCCCTTCCCATCACCCTGGTGGTGAAGCGCACGACGCAGCTAGCA
GACTACGCCTCCCACGGCATCCATCTCGTCAAGCCCTCTTCCTCCTCTTCCTCTTCCTCCTCCTCCTCGTCCTCC
TCGTCCTCCTCTTGCAGCACAGGGTCGACCACGGCCCCGGTCTCGGTAGAGTACTGGTCAGAAACGCCGCCCGAC
CACGGCCCCGTCCGTACCGTAGAACCGATACGGAACCTCATCGTCGCCACCAAGGCTTCCGCCGCCGTGCCGGCT
ATAGATAGATTGCGGCGCTACCTCGGACGGGAGTCGGTCGTCGTCTTGGCTCATAATGGCCTCTGTCGACTTTGG
CACCCAGACGGCGCCCTGTACAAGGCTTTGCGCTGGCCGCCCGCTGCTGACGGCCCGCTCTTTATGGCTGCTGTG
CTTTCGCATGGCTTGTGGGCGACGGATTCGCGGACCAGTATCCATGCTGCCGTCGGACGGGTACTCTTTGGTTCC
CTTTGTGCTGCTGATGCTGATGCTTCCGCCGCCTCCGACTCGGATCTTGCCTCCTCCCCCCGTCGTCCGCACTCT
TCCCGTCTTGCCTCCGGCCCGGATCCCCATCTCACCCGCTCACTGCTCTCCGCCCCCTCTCTTCACGCCGAACTC
CTCCCCCCCTCGGAGCTATGGCTAAGCCAGCTAGAGAAGATGGTGTACAATAGCACCATCAACCCGCTAACCTCC
CTCCTGCGCTGCCCCAACAACGAGCTCCTCTCGTCCCCGACCAGGTCCCGAATCGTGAACCGCCTCCTGTCGGAA
ACGAGCCGCATCCTCACCACCCTCATCGCCCTCCGCGCCCCCGTTCCCCTTCCCCCCCGTTTCTCCCCTTCCGAC
TTCGCTGCCGATAGCCTTCGTGCTAAACTCGACACCTTCATCCCCGCTGTCGGCCCTAATCATAGCTCCATGTTG
CAGCATCTTCGTGCCGGCGTCCAGACCGAGGTTCGCGACTTTAATGGCTGGCTGGTCGAGACCGCTGCTGACCTG
GTCCCCGGCTTTGATCCCCGCACCCATCGCATCCTCGTCGAGCTGGTCGAGGCCGCTAAAGCGGACGATGCGCCT
TGGACCGATCACCAACTCGGCCGTCTCTTGCTTTCTTCATCACCTTCTTCCTCTCTACCTTGA
Gene >Ophio5|6172
ATGGCACGACCAGTACTGCTACGGCTGCACAGCACGACAAGTTCGTCCCCAGTTCGTTTTTTCCATTCGACCTCG
GCTCCTCCTCGCAGCAGCAGCAGCAGCAGCAGCAGCAACAACAAGTCGGCCACGACGAAGAAGCCCGGCTGGCTC
ACGGCGCTCATGGACGCATCTCCCGGTGTAGGACCGCAGCTGTACGCCTGGAACGCAAGTAACGTCGAGACATGC
ACGACGCCGGTTCCGCCTCCTTCGACGACCGAGAGTAGAGGACGAATCTACATCGTGGGCGGCGGTAATATCGGA
CGCCTGTTCGCCATCTGTCTCGCTAGGCTATCCCTTCCCATCACCCTGGTGGTGAAGCGCACGACGCAGCTAGCA
GACTACGCCTCCCACGGCATCCATCTCGTCAAGCCCTCTTCCTCCTCTTCCTCTTCCTCCTCCTCCTCGTCCTCC
TCGTCCTCCTCTTGCAGCACAGGGTCGACCACGGCCCCGGTCTCGGTAGAGTACTGGTCAGAAACGCCGCCCGAC
CACGGCCCCGTCCGTACCGTAGAACCGATACGGAACCTCATCGTCGCCACCAAGGCTTCCGCCGCCGTGCCGGCT
ATAGATAGATTGCGGCGCTACCTCGGACGGGAGTCGGTCGTCGTCTTGGCTCATAATGGCCTCTGTCGACTTTGG
CACCCAGACGGCGCCCTGTACAAGGCTTTGCGCTGGCCGCCCGCTGCTGACGGCCCGCTCTTTATGGCTGCTGTG
CTTTCGCATGGCTTGTGGGCGACGGATTCGCGGACCAGTATCCATGCTGCCGTCGGACGGGTACTCTTTGGTTCC
CTTTGTGCTGCTGATGCTGATGCTTCCGCCGCCTCCGACTCGGATCTTGCCTCCTCCCCCCGTCGTCCGCACTCT
TCCCGTCTTGCCTCCGGCCCGGATCCCCATCTCACCCGCTCACTGCTCTCCGCCCCCTCTCTTCACGCCGAACTC
CTCCCCCCCTCGGAGCTATGGCTAAGCCAGCTAGAGAAGATGGTGTACAATAGCACCATCAACCCGCTAACCTCC
CTCCTGCGCTGCCCCAACAACGAGCTCCTCTCGTCCCCGACCAGGTCCCGAATCGTGAACCGCCTCCTGTCGGAA
ACGAGCCGCATCCTCACCACCCTCATCGCCCTCCGCGCCCCCGTTCCCCTTCCCCCCCGTTTCTCCCCTTCCGAC
TTCGCTGCCGATAGCCTTCGTGCTAAACTCGACACCTTCATCCCCGCTGTCGGCCCTAATCATAGCTCCATGTTG
CAGCATCTTCGTGCCGGCGTCCAGACCGAGGTTCGCGACTTTAATGGCTGGCTGGTCGAGACCGCTGCTGACCTG
GTCCCCGGCTTTGATCCCCGCACCCATCGCATCCTCGTCGAGCTGGTCGAGGCCGCTAAAGCGGACGATGCGCCT
TGGACCGATCACCAACTCGGCCGTCTCTTGCTTTCTTCATCACCTTCTTCCTCTCTACCTTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail