Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|6166
Gene name
Locationscaffold_527:7148..8597
Strand-
Gene length (bp)1449
Transcript length (bp)1332
Coding sequence length (bp)1329
Protein length (aa) 443

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF07690 MFS_1 Major Facilitator Superfamily 6.1E-39 83 396
PF00083 Sugar_tr Sugar (and other) transporter 2.0E-08 82 245

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9D2V8|MFS10_MOUSE Major facilitator superfamily domain-containing protein 10 OS=Mus musculus GN=Mfsd10 PE=1 SV=1 61 414 2.0E-59
sp|Q0P5M9|MFS10_BOVIN Major facilitator superfamily domain-containing protein 10 OS=Bos taurus GN=MFSD10 PE=2 SV=1 61 416 4.0E-55
sp|Q14728|MFS10_HUMAN Major facilitator superfamily domain-containing protein 10 OS=Homo sapiens GN=MFSD10 PE=1 SV=1 60 413 9.0E-51
sp|P51563|TCR7_VIBAN Tetracycline resistance protein, class G OS=Vibrio anguillarum GN=tetA PE=3 SV=1 84 403 1.0E-14
sp|P02981|TCR3_ECOLX Tetracycline resistance protein, class C OS=Escherichia coli GN=tetA PE=1 SV=1 7 403 4.0E-14
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9D2V8|MFS10_MOUSE Major facilitator superfamily domain-containing protein 10 OS=Mus musculus GN=Mfsd10 PE=1 SV=1 61 414 2.0E-59
sp|Q0P5M9|MFS10_BOVIN Major facilitator superfamily domain-containing protein 10 OS=Bos taurus GN=MFSD10 PE=2 SV=1 61 416 4.0E-55
sp|Q14728|MFS10_HUMAN Major facilitator superfamily domain-containing protein 10 OS=Homo sapiens GN=MFSD10 PE=1 SV=1 60 413 9.0E-51
sp|P51563|TCR7_VIBAN Tetracycline resistance protein, class G OS=Vibrio anguillarum GN=tetA PE=3 SV=1 84 403 1.0E-14
sp|P02981|TCR3_ECOLX Tetracycline resistance protein, class C OS=Escherichia coli GN=tetA PE=1 SV=1 7 403 4.0E-14
sp|P02982|TCR1_ECOLX Tetracycline resistance protein, class A OS=Escherichia coli GN=tetA PE=3 SV=2 7 403 4.0E-13
sp|Q07282|TCR5_ECOLX Tetracycline resistance protein, class E OS=Escherichia coli GN=tetA PE=3 SV=1 84 403 1.0E-12
sp|P02980|TCR2_ECOLX Tetracycline resistance protein, class B OS=Escherichia coli GN=tetA PE=1 SV=1 71 403 2.0E-11
sp|Q3EAQ5|PTR36_ARATH Probable peptide/nitrate transporter At3g43790 OS=Arabidopsis thaliana GN=ZIFL2 PE=2 SV=2 74 409 6.0E-10
sp|Q5SR56|HIAL1_HUMAN Hippocampus abundant transcript-like protein 1 OS=Homo sapiens GN=HIATL1 PE=2 SV=3 75 404 2.0E-09
sp|P39843|BMR2_BACSU Multidrug resistance protein 2 OS=Bacillus subtilis (strain 168) GN=blt PE=3 SV=1 83 398 3.0E-09
sp|P33733|TCR4_SALOR Tetracycline resistance protein, class D OS=Salmonella ordonez GN=tetA PE=3 SV=1 4 403 1.0E-08
sp|Q8CIA9|HIAL1_MOUSE Hippocampus abundant transcript-like protein 1 OS=Mus musculus GN=Hiatl1 PE=2 SV=3 81 404 3.0E-08
sp|Q96MC6|HIAT1_HUMAN Hippocampus abundant transcript 1 protein OS=Homo sapiens GN=HIAT1 PE=2 SV=2 81 404 4.0E-08
sp|P70187|HIAT1_MOUSE Hippocampus abundant transcript 1 protein OS=Mus musculus GN=Hiat1 PE=2 SV=3 81 404 4.0E-08
sp|P51564|TCR8_PASMD Tetracycline resistance protein, class H OS=Pasteurella multocida GN=tetA PE=3 SV=1 84 403 1.0E-07
sp|A4IF94|HIAL1_BOVIN Hippocampus abundant transcript-like protein 1 OS=Bos taurus GN=HIATL1 PE=2 SV=1 81 404 5.0E-07
sp|B2RYH9|HIAL1_RAT Hippocampus abundant transcript-like protein 1 OS=Rattus norvegicus GN=Hiatl1 PE=2 SV=1 81 404 8.0E-07
sp|Q8NBP5|MFSD9_HUMAN Major facilitator superfamily domain-containing protein 9 OS=Homo sapiens GN=MFSD9 PE=2 SV=2 84 398 1.0E-06
sp|Q78KK3|S22AI_MOUSE Solute carrier family 22 member 18 OS=Mus musculus GN=Slc22a18 PE=1 SV=2 84 398 2.0E-06
sp|Q6AY78|S22AI_RAT Solute carrier family 22 member 18 OS=Rattus norvegicus GN=Slc22a18 PE=2 SV=2 84 414 2.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0016021 integral component of membrane Yes
GO:0022857 transmembrane transporter activity Yes
GO:0055085 transmembrane transport Yes
GO:0009987 cellular process No
GO:0051234 establishment of localization No
GO:0110165 cellular anatomical entity No
GO:0031224 intrinsic component of membrane No
GO:0008150 biological_process No
GO:0005215 transporter activity No
GO:0005575 cellular_component No
GO:0003674 molecular_function No
GO:0051179 localization No
GO:0006810 transport No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.5

Transmembrane Domains

Domain # Start End Length
1 9 31 22
2 79 101 22
3 113 132 19
4 170 192 22
5 199 221 22
6 260 282 22
7 295 314 19
8 325 347 22
9 410 429 19

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|6166
MATVDRKKVLRVIVVSLLLDLISFTFILPLFPKLLEFYRDREAPSLLEAGPPTLLQRVLGGLHSYKAAFSRPIDS
RHDIVLLGGAMGSLFSLLQAIASPVIGRLSDRYGRRAALLASMCGNILSVLLWVAAVDFRTFIASRIVGGLSEGN
VQLATAIASDISDDASRGSTMAIIGSCFCVAFTFGPALGAWLSTMAILVANPFAMAAGFSLVLIVVETIYLYYYL
PETLPALTQPKSRGHKAEAEAKRQVTPVKRSNSPFLLYAVNFFFLLFFSGMESSLSFMTYDLFAFTSGKNGRLLG
FIGLVASILQGGVTRRMPPLLSIRVGLLACLASFVLLGSITTVVGLYAAATCLATTSATVVTGLNALSSFDASED
ERGSKLGVLRSWGQLGRGLGPILFTSIYWWAGREYAYNVGATGIVMVAAAAFVGLKAPETASAGIKRT
Coding >Ophio5|6166
ATGGCCACTGTCGACAGGAAAAAGGTCCTTCGGGTCATCGTCGTCTCCCTGCTCCTGGATTTGATCTCCTTCACC
TTCATCCTGCCGCTCTTCCCCAAGCTCCTCGAATTCTATCGCGACCGCGAGGCCCCTTCCTTACTCGAAGCCGGC
CCGCCCACCTTGCTTCAGCGCGTACTCGGCGGCCTACACAGTTACAAGGCTGCCTTTTCCCGGCCCATCGATTCG
CGCCATGACATTGTCCTACTGGGCGGAGCCATGGGCTCTCTCTTCTCCCTGCTGCAAGCCATAGCCTCACCCGTC
ATCGGCCGCCTCTCTGACCGGTATGGCCGCCGCGCCGCGCTCCTCGCCTCCATGTGTGGCAACATCCTGTCCGTC
TTACTGTGGGTTGCCGCCGTCGACTTCCGCACCTTCATTGCCAGTCGCATTGTCGGCGGTCTCTCTGAGGGCAAT
GTTCAGCTCGCGACCGCCATAGCCAGCGACATATCGGATGATGCCTCGCGCGGCTCCACCATGGCCATCATCGGC
TCCTGCTTCTGTGTCGCCTTCACCTTTGGCCCGGCCCTGGGTGCCTGGCTTAGCACCATGGCCATTCTCGTCGCG
AACCCCTTTGCCATGGCGGCGGGCTTCAGCCTGGTTCTCATCGTTGTTGAGACGATTTACCTATACTACTACCTG
CCCGAGACGCTTCCCGCCTTGACGCAGCCGAAGAGTCGGGGCCACAAGGCTGAGGCCGAGGCGAAACGCCAGGTG
ACGCCGGTGAAAAGGTCTAACTCACCCTTTCTGCTCTATGCCGTCAATTTCTTCTTTCTGCTCTTCTTCTCCGGC
ATGGAGAGTTCGCTGTCCTTCATGACCTACGATCTCTTCGCCTTTACATCGGGCAAAAACGGTAGACTACTGGGT
TTCATCGGCCTCGTGGCATCCATCCTCCAGGGCGGTGTTACGCGCAGAATGCCGCCTCTCTTGTCCATCCGCGTC
GGCCTCCTGGCCTGCCTCGCGTCCTTTGTCCTACTCGGGAGCATTACCACGGTGGTCGGCCTGTATGCGGCCGCT
ACCTGTCTCGCTACGACGTCGGCCACTGTCGTCACGGGCCTCAATGCGCTAAGTAGTTTTGATGCCAGCGAGGAT
GAGCGTGGGAGCAAGCTGGGAGTCCTGCGCAGCTGGGGTCAGCTGGGGCGCGGGCTGGGCCCCATCCTCTTCACC
AGCATCTACTGGTGGGCGGGGCGAGAGTACGCTTATAACGTCGGCGCGACGGGCATTGTCATGGTGGCGGCAGCC
GCCTTTGTAGGACTCAAGGCGCCCGAGACGGCGAGCGCGGGCATCAAGAGAACG
Transcript >Ophio5|6166
ATGGCCACTGTCGACAGGAAAAAGGTCCTTCGGGTCATCGTCGTCTCCCTGCTCCTGGATTTGATCTCCTTCACC
TTCATCCTGCCGCTCTTCCCCAAGCTCCTCGAATTCTATCGCGACCGCGAGGCCCCTTCCTTACTCGAAGCCGGC
CCGCCCACCTTGCTTCAGCGCGTACTCGGCGGCCTACACAGTTACAAGGCTGCCTTTTCCCGGCCCATCGATTCG
CGCCATGACATTGTCCTACTGGGCGGAGCCATGGGCTCTCTCTTCTCCCTGCTGCAAGCCATAGCCTCACCCGTC
ATCGGCCGCCTCTCTGACCGGTATGGCCGCCGCGCCGCGCTCCTCGCCTCCATGTGTGGCAACATCCTGTCCGTC
TTACTGTGGGTTGCCGCCGTCGACTTCCGCACCTTCATTGCCAGTCGCATTGTCGGCGGTCTCTCTGAGGGCAAT
GTTCAGCTCGCGACCGCCATAGCCAGCGACATATCGGATGATGCCTCGCGCGGCTCCACCATGGCCATCATCGGC
TCCTGCTTCTGTGTCGCCTTCACCTTTGGCCCGGCCCTGGGTGCCTGGCTTAGCACCATGGCCATTCTCGTCGCG
AACCCCTTTGCCATGGCGGCGGGCTTCAGCCTGGTTCTCATCGTTGTTGAGACGATTTACCTATACTACTACCTG
CCCGAGACGCTTCCCGCCTTGACGCAGCCGAAGAGTCGGGGCCACAAGGCTGAGGCCGAGGCGAAACGCCAGGTG
ACGCCGGTGAAAAGGTCTAACTCACCCTTTCTGCTCTATGCCGTCAATTTCTTCTTTCTGCTCTTCTTCTCCGGC
ATGGAGAGTTCGCTGTCCTTCATGACCTACGATCTCTTCGCCTTTACATCGGGCAAAAACGGTAGACTACTGGGT
TTCATCGGCCTCGTGGCATCCATCCTCCAGGGCGGTGTTACGCGCAGAATGCCGCCTCTCTTGTCCATCCGCGTC
GGCCTCCTGGCCTGCCTCGCGTCCTTTGTCCTACTCGGGAGCATTACCACGGTGGTCGGCCTGTATGCGGCCGCT
ACCTGTCTCGCTACGACGTCGGCCACTGTCGTCACGGGCCTCAATGCGCTAAGTAGTTTTGATGCCAGCGAGGAT
GAGCGTGGGAGCAAGCTGGGAGTCCTGCGCAGCTGGGGTCAGCTGGGGCGCGGGCTGGGCCCCATCCTCTTCACC
AGCATCTACTGGTGGGCGGGGCGAGAGTACGCTTATAACGTCGGCGCGACGGGCATTGTCATGGTGGCGGCAGCC
GCCTTTGTAGGACTCAAGGCGCCCGAGACGGCGAGCGCGGGCATCAAGAGAACGTAG
Gene >Ophio5|6166
ATGGCCACTGTCGACAGGAAAAAGGTCCTTCGGGTCATCGTCGTCTCCCTGCTCCTGGATTTGGTGAGTGGCGCC
CCGGGCGGAGACGCCAAGCAACGAAACTCTCCGCTGACTCTCCACCGAGATCTCCTTCACCTTCATCCTGCCGCT
CTTCCCCAAGCTCCTCGAATTCTATCGCGACCGCGAGGCCCCTTCCTTACTCGAAGCCGGCCCGCCCACCTTGCT
TCAGCGCGTACTCGGCGGCCTACACAGTTACAAGGCTGCCTTTTCCCGGCCCATCGATTCGCGCCATGACATTGT
CCTACTGGGCGGAGCCATGGGCTCTCTCTTCTCGTGCGCCACTCTCACATTCCATTCCATCCGCCCGTATCTCGC
TAACCACTCCACAGCCTGCTGCAAGCCATAGCCTCACCCGTCATCGGCCGCCTCTCTGACCGGTATGGCCGCCGC
GCCGCGCTCCTCGCCTCCATGTGTGGCAACATCCTGTCCGTCTTACTGTGGGTTGCCGCCGTCGACTTCCGCACC
TTCATTGCCAGTCGCATTGTCGGCGGTCTCTCTGAGGGCAATGTTCAGCTCGCGACCGCCATAGCCAGCGACATA
TCGGATGATGCCTCGCGCGGCTCCACCATGGCCATCATCGGCTCCTGCTTCTGTGTCGCCTTCACCTTTGGCCCG
GCCCTGGGTGCCTGGCTTAGCACCATGGCCATTCTCGTCGCGAACCCCTTTGCCATGGCGGCGGGCTTCAGCCTG
GTTCTCATCGTTGTTGAGACGATTTACCTATACTACTACCTGCCCGAGACGCTTCCCGCCTTGACGCAGCCGAAG
AGTCGGGGCCACAAGGCTGAGGCCGAGGCGAAACGCCAGGTGACGCCGGTGAAAAGGTCTAACTCACCCTTTCTG
CTCTATGCCGTCAATTTCTTCTTTCTGCTCTTCTTCTCCGGCATGGAGAGTTCGCTGTCCTTCATGACCTACGAT
CTCTTCGCCTTTACATCGGGCAAAAACGGTAGACTACTGGGTTTCATCGGCCTCGTGGCATCCATCCTCCAGGGC
GGTGTTACGCGCAGAATGCCGCCTCTCTTGTCCATCCGCGTCGGCCTCCTGGCCTGCCTCGCGTCCTTTGTCCTA
CTCGGGAGCATTACCACGGTGGTCGGCCTGTATGCGGCCGCTACCTGTCTCGCTACGACGTCGGCCACTGTCGTC
ACGGGCCTCAATGCGCTAAGTAGTTTTGATGCCAGCGAGGATGAGCGTGGGAGCAAGCTGGGAGTCCTGCGCAGC
TGGGGTCAGCTGGGGCGCGGGCTGGGCCCCATCCTCTTCACCAGCATCTACTGGTGGGCGGGGCGAGAGTACGCT
TATAACGTCGGCGCGACGGGCATTGTCATGGTGGCGGCAGCCGCCTTTGTAGGACTCAAGGCGCCCGAGACGGCG
AGCGCGGGCATCAAGAGAACGTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail