Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|616
Gene name
Locationscaffold_1160:2151..3113
Strand-
Gene length (bp)962
Transcript length (bp)864
Coding sequence length (bp)861
Protein length (aa) 287

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01871 AMMECR1 AMMECR1 5.0E-45 79 252

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9ZVJ2|AMERL_ARATH Uncharacterized protein At2g38710 OS=Arabidopsis thaliana GN=At2g38710 PE=2 SV=1 100 261 1.0E-43
sp|Q22004|AMERL_CAEEL Uncharacterized protein R166.3 OS=Caenorhabditis elegans GN=R166.3 PE=3 SV=1 97 259 4.0E-42
sp|Q5RDQ3|AMERL_PONAB AMMECR1-like protein OS=Pongo abelii GN=AMMECR1L PE=2 SV=1 108 284 9.0E-42
sp|Q6DCA0|AMERL_HUMAN AMMECR1-like protein OS=Homo sapiens GN=AMMECR1L PE=1 SV=1 108 284 9.0E-42
sp|Q8JZZ6|AMERL_MOUSE AMMECR1-like protein OS=Mus musculus GN=Ammecr1l PE=1 SV=1 108 284 1.0E-41
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9ZVJ2|AMERL_ARATH Uncharacterized protein At2g38710 OS=Arabidopsis thaliana GN=At2g38710 PE=2 SV=1 100 261 1.0E-43
sp|Q22004|AMERL_CAEEL Uncharacterized protein R166.3 OS=Caenorhabditis elegans GN=R166.3 PE=3 SV=1 97 259 4.0E-42
sp|Q5RDQ3|AMERL_PONAB AMMECR1-like protein OS=Pongo abelii GN=AMMECR1L PE=2 SV=1 108 284 9.0E-42
sp|Q6DCA0|AMERL_HUMAN AMMECR1-like protein OS=Homo sapiens GN=AMMECR1L PE=1 SV=1 108 284 9.0E-42
sp|Q8JZZ6|AMERL_MOUSE AMMECR1-like protein OS=Mus musculus GN=Ammecr1l PE=1 SV=1 108 284 1.0E-41
sp|Q9VCF0|Y5902_DROME Uncharacterized protein CG5902 OS=Drosophila melanogaster GN=CG5902 PE=2 SV=1 101 261 3.0E-41
sp|Q5RAS7|AMMR1_PONAB AMME syndrome candidate gene 1 protein homolog OS=Pongo abelii GN=AMMECR1 PE=2 SV=1 97 259 2.0E-40
sp|Q9Y4X0|AMMR1_HUMAN AMME syndrome candidate gene 1 protein OS=Homo sapiens GN=AMMECR1 PE=1 SV=1 97 259 2.0E-40
sp|Q9JHT5|AMMR1_MOUSE AMME syndrome candidate gene 1 protein homolog OS=Mus musculus GN=Ammecr1 PE=2 SV=1 97 259 2.0E-40
sp|Q9P6M2|YKQ3_SCHPO Uncharacterized protein C688.03c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC688.03c PE=3 SV=2 106 263 7.0E-36
sp|Q9URS8|Y464_KLULA Uncharacterized protein KLLA0D02464g OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=KLLA0D02464g PE=3 SV=1 107 263 9.0E-33
sp|Q12012|YO289_YEAST Uncharacterized protein YOR289W OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YOR289W PE=1 SV=1 106 263 2.0E-32
sp|Q4JAL7|Y792_SULAC Protein Saci_0792 OS=Sulfolobus acidocaldarius (strain ATCC 33909 / DSM 639 / JCM 8929 / NBRC 15157 / NCIMB 11770) GN=Saci_0792 PE=3 SV=1 110 241 8.0E-14
sp|Q976G0|Y229_SULTO Protein STK_02290 OS=Sulfolobus tokodaii (strain DSM 16993 / JCM 10545 / NBRC 100140 / 7) GN=STK_02290 PE=1 SV=1 110 249 1.0E-11
sp|Q8TY18|Y488_METKA Protein MK0488 OS=Methanopyrus kandleri (strain AV19 / DSM 6324 / JCM 9639 / NBRC 100938) GN=MK0488 PE=3 SV=1 109 229 1.0E-09
sp|O26945|Y857_METTH Protein MTH_857 OS=Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H) GN=MTH_857 PE=3 SV=1 122 229 3.0E-09
sp|Q58220|Y810_METJA Protein MJ0810 OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=MJ0810 PE=3 SV=2 110 229 1.0E-08
sp|A1RT97|Y1005_PYRIL Protein Pisl_1005 OS=Pyrobaculum islandicum (strain DSM 4184 / JCM 9189 / GEO3) GN=Pisl_1005 PE=3 SV=1 98 250 2.0E-08
sp|A6UTA8|Y138_META3 Protein Maeo_0138 OS=Methanococcus aeolicus (strain Nankai-3 / ATCC BAA-1280) GN=Maeo_0138 PE=3 SV=1 122 229 3.0E-08
sp|O67431|Y1444_AQUAE Protein aq_1444 OS=Aquifex aeolicus (strain VF5) GN=aq_1444 PE=3 SV=1 109 250 4.0E-07
sp|Q5JFK7|Y174_THEKO Protein TK0174 OS=Thermococcus kodakarensis (strain ATCC BAA-918 / JCM 12380 / KOD1) GN=TK0174 PE=3 SV=1 102 229 6.0E-07
sp|C5A6U0|Y1450_THEGJ Protein TGAM_1450 OS=Thermococcus gammatolerans (strain DSM 15229 / JCM 11827 / EJ3) GN=TGAM_1450 PE=3 SV=1 102 229 1.0E-06
sp|Q9X1N7|Y1551_THEMA Protein TM_1551 OS=Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099) GN=TM_1551 PE=3 SV=1 115 247 2.0E-06
sp|B6YW91|Y1965_THEON Protein TON_1965 OS=Thermococcus onnurineus (strain NA1) GN=TON_1965 PE=3 SV=1 102 229 2.0E-06
sp|Q46BJ4|Y1807_METBF Protein Mbar_A1807 OS=Methanosarcina barkeri (strain Fusaro / DSM 804) GN=Mbar_A1807 PE=3 SV=1 123 231 3.0E-06
sp|A3DP40|Y1309_STAMF Protein Smar_1309 OS=Staphylothermus marinus (strain ATCC 43588 / DSM 3639 / JCM 9404 / F1) GN=Smar_1309 PE=3 SV=1 110 250 3.0E-06
sp|O57770|Y010_PYRHO Protein PH0010 OS=Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3) GN=PH0010 PE=1 SV=1 102 229 4.0E-06
sp|Q8TK33|Y3591_METAC Protein MA_3591 OS=Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A) GN=MA_3591 PE=3 SV=1 100 230 6.0E-06
sp|Q9V2R5|Y010_PYRAB Protein PYRAB00100 OS=Pyrococcus abyssi (strain GE5 / Orsay) GN=PYRAB00100 PE=3 SV=1 102 229 6.0E-06
sp|Q8TZL1|Y1979_PYRFU Protein PF1979 OS=Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1) GN=PF1979 PE=3 SV=1 109 229 9.0E-06
[Show less]

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm 0.7143 0.3301 0.138 0.0445 0.5258 0.0914 0.4491 0.1916 0.1833 0.2087

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup3151
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|3779
Ophiocordyceps australis map64 (Brazil) OphauB2|7912
Ophiocordyceps camponoti-floridani Ophcf2|05248
Ophiocordyceps camponoti-rufipedis Ophun1|1986
Ophiocordyceps kimflemingae Ophio5|616 (this protein)
Ophiocordyceps subramaniannii Hirsu2|5548

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|616
MASAEHCILCFDALDAFLHHRKPIPLDGIQSSWAAFSASNLPATLKDPALRRVAAASSSSSSSSSSSSSSSASTS
SSSSTASPALASTPATSTSSLPLSPPSPPTSTPLFVTWNTVSDGDVSLRGCIGTFESQPLAIGIPEYAVTSAIQD
TRFPPIDKAELPSLQAAVTLLTDFEEADDLYDWQVGTHGIRLSFIDRGRRYGSTYLPDVASDQGWSKDETLFNLI
RKAGWMGSRSRWKDLDLDLTRYQGKKCVMDYSEYKSELIVESPLSFFTLFSPCLYVSHSAPP
Coding >Ophio5|616
ATGGCCTCGGCTGAGCATTGCATCTTGTGCTTCGACGCCCTCGATGCTTTTCTCCATCATCGCAAGCCCATACCT
CTAGATGGCATTCAGTCGTCTTGGGCCGCCTTTTCCGCCTCCAACCTCCCCGCGACTCTCAAGGATCCCGCTCTT
CGCCGCGTGGCCGCCGCCTCTTCATCATCATCATCCTCCTCCTCCTCCTCGTCATCCTCTTCCGCCTCGACGTCG
TCCTCTTCTTCTACAGCCTCACCCGCTCTGGCCTCCACCCCCGCAACCTCCACGTCTTCCCTCCCTCTGAGTCCC
CCTTCCCCCCCGACGTCGACGCCCCTGTTCGTCACGTGGAACACCGTCTCAGATGGCGACGTCTCCCTGCGCGGC
TGCATCGGCACCTTCGAGTCCCAGCCGCTGGCCATCGGTATCCCGGAATACGCCGTCACGTCCGCTATTCAGGAC
ACCCGCTTCCCGCCCATTGACAAGGCCGAGCTGCCGTCGTTGCAGGCTGCCGTCACTCTTCTTACCGACTTTGAG
GAGGCGGATGACTTGTACGATTGGCAGGTAGGCACTCACGGCATCCGCCTCTCGTTTATCGACCGCGGGCGCCGA
TACGGCTCGACCTACTTGCCCGACGTCGCCTCCGATCAGGGCTGGTCCAAGGATGAGACGCTCTTCAACCTCATT
CGCAAGGCCGGCTGGATGGGCAGCCGTTCCCGTTGGAAAGACCTCGACCTCGACCTGACGCGCTACCAGGGCAAG
AAATGCGTCATGGACTATTCAGAGTACAAGAGCGAGCTCATCGTCGAGTCTCCCCTCTCCTTCTTCACCCTCTTT
TCCCCTTGTCTCTACGTCAGCCACAGCGCTCCGCCA
Transcript >Ophio5|616
ATGGCCTCGGCTGAGCATTGCATCTTGTGCTTCGACGCCCTCGATGCTTTTCTCCATCATCGCAAGCCCATACCT
CTAGATGGCATTCAGTCGTCTTGGGCCGCCTTTTCCGCCTCCAACCTCCCCGCGACTCTCAAGGATCCCGCTCTT
CGCCGCGTGGCCGCCGCCTCTTCATCATCATCATCCTCCTCCTCCTCCTCGTCATCCTCTTCCGCCTCGACGTCG
TCCTCTTCTTCTACAGCCTCACCCGCTCTGGCCTCCACCCCCGCAACCTCCACGTCTTCCCTCCCTCTGAGTCCC
CCTTCCCCCCCGACGTCGACGCCCCTGTTCGTCACGTGGAACACCGTCTCAGATGGCGACGTCTCCCTGCGCGGC
TGCATCGGCACCTTCGAGTCCCAGCCGCTGGCCATCGGTATCCCGGAATACGCCGTCACGTCCGCTATTCAGGAC
ACCCGCTTCCCGCCCATTGACAAGGCCGAGCTGCCGTCGTTGCAGGCTGCCGTCACTCTTCTTACCGACTTTGAG
GAGGCGGATGACTTGTACGATTGGCAGGTAGGCACTCACGGCATCCGCCTCTCGTTTATCGACCGCGGGCGCCGA
TACGGCTCGACCTACTTGCCCGACGTCGCCTCCGATCAGGGCTGGTCCAAGGATGAGACGCTCTTCAACCTCATT
CGCAAGGCCGGCTGGATGGGCAGCCGTTCCCGTTGGAAAGACCTCGACCTCGACCTGACGCGCTACCAGGGCAAG
AAATGCGTCATGGACTATTCAGAGTACAAGAGCGAGCTCATCGTCGAGTCTCCCCTCTCCTTCTTCACCCTCTTT
TCCCCTTGTCTCTACGTCAGCCACAGCGCTCCGCCATGA
Gene >Ophio5|616
ATGGCCTCGGCTGAGCATTGCATCTTGTGCTTCGACGCCCTCGATGCTTTTCTCCATCATCGCAAGCCCATACCT
CTAGATGGCATTCAGTCGTCTTGGGCCGCCTTTTCCGCCTCCAACCTCCCCGCGACTCTCAAGGATCCCGCTCTT
CGCCGCGTGGCCGCCGCCTCTTCATCATCATCATCCTCCTCCTCCTCCTCGTCATCCTCTTCCGCCTCGACGTCG
TCCTCTTCTTCTACAGCCTCACCCGCTCTGGCCTCCACCCCCGCAACCTCCACGTCTTCCCTCCCTCTGAGTCCC
CCTTCCCCCCCGACGTCGACGCCCCTGTTCGTCACGTGGAACACCGTCTCAGATGGCGACGTCTCCCTGCGCGGC
TGCATCGGCACCTTCGAGTCCCAGCCGCTGGCCATCGGTATCCCGGAATACGCCGTCACGTCCGCTATTCAGGAC
ACCCGCTTCCCGCCCATTGACAAGGCCGAGCTGCCGTCGTTGCAGGCTGCCGTCACTCTTCTTACCGACTTTGAG
GAGGCGGATGACTTGTACGATTGGCAGGTAGGCACTCACGGCATCCGCCTCTCGTTTATCGACCGCGGGCGCCGA
TACGGCTCGACCTACTTGCCCGACGTCGCCTCCGATCAGGGCTGGTCCAAGGATGAGACGCTCTTCAACCTCATT
CGCAAGGCCGGCTGGATGGGCAGCCGTTCCCGTTGGAAAGACCTCGACCTCGACCTGACGCGCTACCAGGGCAAG
AAATGCGTCATGGACTATTCAGAGTACAAGAGGTGGCGCGACTGGATGGCGGCGACCAAGCAGTGACCCGAGCGA
GCTCATCGTCGAGTCTCCCCTCTCCTTCTTCACCCTCTTTTCCCCTTGTCTCTGTGCGCTTCCCGGTCCATGATT
GCGTCTCTGCTTCATCTGACAGGCTCGGAGTCAAAGACGTCAGCCACAGCGCTCCGCCATGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail