Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|6159
Gene name
Locationscaffold_525:10465..12199
Strand-
Gene length (bp)1734
Transcript length (bp)1734
Coding sequence length (bp)1731
Protein length (aa) 577

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF09286 Pro-kuma_activ Pro-kumamolisin, activation domain 1.5E-23 37 160
PF00082 Peptidase_S8 Subtilase family 9.3E-06 318 506

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q70J59|SED2_ASPFU Tripeptidyl-peptidase sed2 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=sed2 PE=1 SV=1 23 575 8.0E-119
sp|C5FTQ5|SED3_ARTOC Tripeptidyl-peptidase SED3 OS=Arthroderma otae (strain ATCC MYA-4605 / CBS 113480) GN=SED3 PE=3 SV=1 13 576 5.0E-106
sp|Q4WQU0|SED4_ASPFU Tripeptidyl-peptidase sed4 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=sed4 PE=1 SV=1 1 566 1.0E-103
sp|Q70GH4|SED3_ASPFU Tripeptidyl-peptidase sed3 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=sed3 PE=1 SV=1 20 566 9.0E-103
sp|C5FRX4|SED4_ARTOC Tripeptidyl-peptidase SED4 OS=Arthroderma otae (strain ATCC MYA-4605 / CBS 113480) GN=SED4 PE=3 SV=1 1 566 2.0E-102
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q70J59|SED2_ASPFU Tripeptidyl-peptidase sed2 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=sed2 PE=1 SV=1 23 575 8.0E-119
sp|C5FTQ5|SED3_ARTOC Tripeptidyl-peptidase SED3 OS=Arthroderma otae (strain ATCC MYA-4605 / CBS 113480) GN=SED3 PE=3 SV=1 13 576 5.0E-106
sp|Q4WQU0|SED4_ASPFU Tripeptidyl-peptidase sed4 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=sed4 PE=1 SV=1 1 566 1.0E-103
sp|Q70GH4|SED3_ASPFU Tripeptidyl-peptidase sed3 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=sed3 PE=1 SV=1 20 566 9.0E-103
sp|C5FRX4|SED4_ARTOC Tripeptidyl-peptidase SED4 OS=Arthroderma otae (strain ATCC MYA-4605 / CBS 113480) GN=SED4 PE=3 SV=1 1 566 2.0E-102
sp|D4ANG0|SED2_ARTBC Probable tripeptidyl-peptidase SED2 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=SED2 PE=1 SV=1 16 576 1.0E-98
sp|C5FBW2|SED2_ARTOC Tripeptidyl-peptidase SED2 OS=Arthroderma otae (strain ATCC MYA-4605 / CBS 113480) GN=SED2 PE=3 SV=1 22 576 7.0E-98
sp|D4D9U2|SED4_TRIVH Probable tripeptidyl-peptidase SED4 OS=Trichophyton verrucosum (strain HKI 0517) GN=SED4 PE=3 SV=2 1 572 1.0E-97
sp|D4DBH6|SED2_TRIVH Probable tripeptidyl-peptidase SED2 OS=Trichophyton verrucosum (strain HKI 0517) GN=SED2 PE=3 SV=1 16 576 1.0E-97
sp|D4AIK6|SED4_ARTBC Probable tripeptidyl-peptidase SED4 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=SED4 PE=1 SV=1 1 572 2.0E-97
sp|D4AK75|SED3_ARTBC Probable tripeptidyl-peptidase SED3 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=SED3 PE=3 SV=2 21 566 3.0E-97
sp|D4D7N6|SED3_TRIVH Probable tripeptidyl-peptidase SED3 OS=Trichophyton verrucosum (strain HKI 0517) GN=SED3 PE=3 SV=2 21 566 4.0E-96
sp|O14773|TPP1_HUMAN Tripeptidyl-peptidase 1 OS=Homo sapiens GN=TPP1 PE=1 SV=2 4 566 1.0E-54
sp|Q5IS74|TPP1_PANTR Tripeptidyl-peptidase 1 OS=Pan troglodytes GN=TPP1 PE=2 SV=1 4 566 2.0E-54
sp|Q70DX9|SED1_ASPFU Tripeptidyl-peptidase sed1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=sed1 PE=1 SV=1 23 566 6.0E-54
sp|Q60HH1|TPP1_MACFA Tripeptidyl-peptidase 1 OS=Macaca fascicularis GN=TPP1 PE=2 SV=2 4 566 9.0E-54
sp|O89023|TPP1_MOUSE Tripeptidyl-peptidase 1 OS=Mus musculus GN=Tpp1 PE=1 SV=2 4 566 2.0E-53
sp|Q9XSB8|TPP1_CANLF Tripeptidyl-peptidase 1 OS=Canis lupus familiaris GN=TPP1 PE=3 SV=1 23 566 2.0E-52
sp|Q5RFL1|TPP1_PONAB Tripeptidyl-peptidase 1 OS=Pongo abelii GN=TPP1 PE=2 SV=1 4 566 6.0E-52
sp|Q9EQV6|TPP1_RAT Tripeptidyl-peptidase 1 OS=Rattus norvegicus GN=Tpp1 PE=1 SV=1 3 566 1.0E-51
sp|Q0V8B6|TPP1_BOVIN Tripeptidyl-peptidase 1 OS=Bos taurus GN=TPP1 PE=2 SV=1 6 566 2.0E-51
sp|Q8NK92|AORSN_ASPOR Aorsin OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=aorO PE=1 SV=2 67 566 2.0E-50
sp|C5FHK0|SED1_ARTOC Tripeptidyl-peptidase SED1 OS=Arthroderma otae (strain ATCC MYA-4605 / CBS 113480) GN=SED1 PE=3 SV=1 22 576 4.0E-39
sp|Q55CT0|TPP1_DICDI Tripeptidyl-peptidase 1 OS=Dictyostelium discoideum GN=tpp1 PE=3 SV=1 45 567 1.0E-33
sp|Q8MZS4|PHYSA_PHYPO Physarolisin OS=Physarum polycephalum PE=1 SV=1 45 566 2.0E-30
sp|Q4WGU1|SED5_ASPFU Tripeptidyl-peptidase sed5 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=sed5 PE=3 SV=2 327 565 7.0E-10
[Show less]

GO

GO Term Description Terminal node
GO:0006508 proteolysis Yes
GO:0008236 serine-type peptidase activity Yes
GO:0016787 hydrolase activity No
GO:0008152 metabolic process No
GO:0140096 catalytic activity, acting on a protein No
GO:0071704 organic substance metabolic process No
GO:0044238 primary metabolic process No
GO:0003824 catalytic activity No
GO:0008150 biological_process No
GO:0008233 peptidase activity No
GO:0006807 nitrogen compound metabolic process No
GO:0003674 molecular_function No
GO:1901564 organonitrogen compound metabolic process No
GO:0019538 protein metabolic process No
GO:0043170 macromolecule metabolic process No
GO:0017171 serine hydrolase activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 21 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|6159
MALALLVAAWAFAGLGDCMAAVEKATVIPEGWQKLQQGPEPSYPLRMSFALSQPKAEGLSDAIVQGRHISREDVL
AMRQPDPAHVDSVERWLAANGISETKCENDWVHVRTTVGDAEKLLGMKMSRYSFQGQAPVLRTTEYSIPDSLSKA
ITFVHPIANFMTPEHDVAAARPMNPLQRRADEALSHDCQRSIQPRCILDQYRINYSAPQGKSPSRFAVAGFLDQF
ANYRDTFDFLNQTMKGRIPYSYNFSVEYINGGQNSQDPTKAGSEANLDMEYAMAIGYPTQITYYSTGGRGIKIND
SGEPFPEEYSDNEPYLQMVEYMLALPDDKLPHVISMSYADDELSVPRPYAERVCGLMGMLTNRGTSIIVASGDGG
ARGGRSSSCRTNDGSNKEITMATFPGSCPWVTSVGATTNQAVPQGAYFSTGGFSQWFRQPPWQKEAVDTYVRDHL
KGYMRGYYNPGMRAIPDISAVGTQFSTIVSGVPVALDGTSASAPVFAAMIALVNDARLRQGKRALGWLNKKLYSP
DVRKVLSDITLGTSKGCPFGGKELGWPAATGWDAITGLGTPGEFEHFLSVMA
Coding >Ophio5|6159
ATGGCGCTGGCTCTTCTCGTGGCCGCTTGGGCCTTTGCCGGTCTGGGTGACTGCATGGCCGCCGTCGAAAAGGCC
ACCGTCATCCCTGAAGGCTGGCAGAAGCTTCAGCAAGGGCCCGAACCGAGCTACCCGCTGCGCATGTCGTTTGCC
CTCAGCCAGCCCAAAGCTGAGGGCCTCTCGGACGCCATCGTCCAAGGTCGTCACATCTCGCGAGAGGATGTGCTG
GCGATGCGGCAACCGGATCCTGCCCACGTCGATAGCGTCGAGCGCTGGCTGGCTGCCAATGGTATCAGTGAGACC
AAGTGCGAGAATGACTGGGTTCACGTCCGTACGACTGTCGGCGACGCTGAGAAGCTCCTCGGCATGAAGATGAGT
CGCTATTCTTTTCAGGGCCAGGCGCCGGTCCTCCGCACCACGGAATATTCCATACCCGACTCTCTTTCCAAGGCC
ATCACCTTCGTTCATCCCATCGCCAACTTCATGACGCCCGAGCACGACGTGGCCGCGGCCCGCCCCATGAATCCG
CTCCAGAGACGAGCCGACGAAGCCCTCTCGCACGACTGTCAGCGCTCGATCCAGCCTCGTTGCATTCTAGACCAG
TACCGCATCAATTATTCGGCGCCCCAAGGCAAGTCGCCTTCGCGCTTCGCTGTGGCCGGCTTCTTGGACCAGTTC
GCCAATTACCGGGACACGTTCGATTTCCTCAACCAGACGATGAAGGGCAGGATCCCCTATTCATACAACTTCTCC
GTCGAGTACATCAACGGCGGCCAGAACAGTCAGGATCCGACAAAGGCCGGCTCCGAGGCCAACCTGGACATGGAG
TACGCCATGGCCATAGGCTATCCCACCCAAATCACCTACTACTCGACGGGCGGTCGCGGTATCAAGATCAACGAC
TCGGGCGAGCCCTTCCCCGAGGAGTATTCGGACAATGAGCCCTACCTGCAGATGGTCGAGTACATGCTGGCCCTG
CCGGATGACAAGCTGCCCCACGTCATCAGCATGTCGTACGCCGACGACGAGCTCTCGGTGCCCAGGCCGTACGCC
GAGCGTGTCTGCGGGCTGATGGGCATGCTGACGAACCGCGGCACGTCCATCATCGTGGCCTCGGGAGATGGCGGA
GCTAGGGGAGGCCGCAGCTCGTCGTGCCGGACCAACGACGGCTCCAACAAGGAGATCACCATGGCCACCTTCCCG
GGCTCCTGTCCGTGGGTGACGTCGGTCGGGGCGACGACCAACCAGGCCGTCCCTCAGGGCGCCTACTTCAGCACC
GGCGGCTTCTCCCAATGGTTCCGGCAACCGCCGTGGCAAAAGGAGGCCGTCGACACGTACGTCAGGGACCATCTC
AAGGGCTACATGCGCGGCTACTACAACCCGGGCATGCGCGCCATACCGGACATCTCGGCCGTCGGAACCCAGTTC
TCGACCATTGTCAGCGGCGTGCCCGTCGCCCTGGACGGCACCAGCGCCAGCGCGCCCGTCTTCGCCGCCATGATT
GCCCTCGTCAACGACGCTCGCCTGCGTCAGGGCAAGCGGGCGCTCGGATGGCTCAACAAGAAGCTGTACTCTCCC
GACGTGCGAAAGGTGCTCTCCGACATCACGCTGGGTACCAGTAAAGGCTGCCCCTTTGGCGGAAAAGAGCTCGGC
TGGCCGGCTGCCACGGGCTGGGACGCCATTACGGGGCTGGGCACGCCTGGTGAATTCGAACACTTCTTGTCCGTC
ATGGCC
Transcript >Ophio5|6159
ATGGCGCTGGCTCTTCTCGTGGCCGCTTGGGCCTTTGCCGGTCTGGGTGACTGCATGGCCGCCGTCGAAAAGGCC
ACCGTCATCCCTGAAGGCTGGCAGAAGCTTCAGCAAGGGCCCGAACCGAGCTACCCGCTGCGCATGTCGTTTGCC
CTCAGCCAGCCCAAAGCTGAGGGCCTCTCGGACGCCATCGTCCAAGGTCGTCACATCTCGCGAGAGGATGTGCTG
GCGATGCGGCAACCGGATCCTGCCCACGTCGATAGCGTCGAGCGCTGGCTGGCTGCCAATGGTATCAGTGAGACC
AAGTGCGAGAATGACTGGGTTCACGTCCGTACGACTGTCGGCGACGCTGAGAAGCTCCTCGGCATGAAGATGAGT
CGCTATTCTTTTCAGGGCCAGGCGCCGGTCCTCCGCACCACGGAATATTCCATACCCGACTCTCTTTCCAAGGCC
ATCACCTTCGTTCATCCCATCGCCAACTTCATGACGCCCGAGCACGACGTGGCCGCGGCCCGCCCCATGAATCCG
CTCCAGAGACGAGCCGACGAAGCCCTCTCGCACGACTGTCAGCGCTCGATCCAGCCTCGTTGCATTCTAGACCAG
TACCGCATCAATTATTCGGCGCCCCAAGGCAAGTCGCCTTCGCGCTTCGCTGTGGCCGGCTTCTTGGACCAGTTC
GCCAATTACCGGGACACGTTCGATTTCCTCAACCAGACGATGAAGGGCAGGATCCCCTATTCATACAACTTCTCC
GTCGAGTACATCAACGGCGGCCAGAACAGTCAGGATCCGACAAAGGCCGGCTCCGAGGCCAACCTGGACATGGAG
TACGCCATGGCCATAGGCTATCCCACCCAAATCACCTACTACTCGACGGGCGGTCGCGGTATCAAGATCAACGAC
TCGGGCGAGCCCTTCCCCGAGGAGTATTCGGACAATGAGCCCTACCTGCAGATGGTCGAGTACATGCTGGCCCTG
CCGGATGACAAGCTGCCCCACGTCATCAGCATGTCGTACGCCGACGACGAGCTCTCGGTGCCCAGGCCGTACGCC
GAGCGTGTCTGCGGGCTGATGGGCATGCTGACGAACCGCGGCACGTCCATCATCGTGGCCTCGGGAGATGGCGGA
GCTAGGGGAGGCCGCAGCTCGTCGTGCCGGACCAACGACGGCTCCAACAAGGAGATCACCATGGCCACCTTCCCG
GGCTCCTGTCCGTGGGTGACGTCGGTCGGGGCGACGACCAACCAGGCCGTCCCTCAGGGCGCCTACTTCAGCACC
GGCGGCTTCTCCCAATGGTTCCGGCAACCGCCGTGGCAAAAGGAGGCCGTCGACACGTACGTCAGGGACCATCTC
AAGGGCTACATGCGCGGCTACTACAACCCGGGCATGCGCGCCATACCGGACATCTCGGCCGTCGGAACCCAGTTC
TCGACCATTGTCAGCGGCGTGCCCGTCGCCCTGGACGGCACCAGCGCCAGCGCGCCCGTCTTCGCCGCCATGATT
GCCCTCGTCAACGACGCTCGCCTGCGTCAGGGCAAGCGGGCGCTCGGATGGCTCAACAAGAAGCTGTACTCTCCC
GACGTGCGAAAGGTGCTCTCCGACATCACGCTGGGTACCAGTAAAGGCTGCCCCTTTGGCGGAAAAGAGCTCGGC
TGGCCGGCTGCCACGGGCTGGGACGCCATTACGGGGCTGGGCACGCCTGGTGAATTCGAACACTTCTTGTCCGTC
ATGGCCTAG
Gene >Ophio5|6159
ATGGCGCTGGCTCTTCTCGTGGCCGCTTGGGCCTTTGCCGGTCTGGGTGACTGCATGGCCGCCGTCGAAAAGGCC
ACCGTCATCCCTGAAGGCTGGCAGAAGCTTCAGCAAGGGCCCGAACCGAGCTACCCGCTGCGCATGTCGTTTGCC
CTCAGCCAGCCCAAAGCTGAGGGCCTCTCGGACGCCATCGTCCAAGGTCGTCACATCTCGCGAGAGGATGTGCTG
GCGATGCGGCAACCGGATCCTGCCCACGTCGATAGCGTCGAGCGCTGGCTGGCTGCCAATGGTATCAGTGAGACC
AAGTGCGAGAATGACTGGGTTCACGTCCGTACGACTGTCGGCGACGCTGAGAAGCTCCTCGGCATGAAGATGAGT
CGCTATTCTTTTCAGGGCCAGGCGCCGGTCCTCCGCACCACGGAATATTCCATACCCGACTCTCTTTCCAAGGCC
ATCACCTTCGTTCATCCCATCGCCAACTTCATGACGCCCGAGCACGACGTGGCCGCGGCCCGCCCCATGAATCCG
CTCCAGAGACGAGCCGACGAAGCCCTCTCGCACGACTGTCAGCGCTCGATCCAGCCTCGTTGCATTCTAGACCAG
TACCGCATCAATTATTCGGCGCCCCAAGGCAAGTCGCCTTCGCGCTTCGCTGTGGCCGGCTTCTTGGACCAGTTC
GCCAATTACCGGGACACGTTCGATTTCCTCAACCAGACGATGAAGGGCAGGATCCCCTATTCATACAACTTCTCC
GTCGAGTACATCAACGGCGGCCAGAACAGTCAGGATCCGACAAAGGCCGGCTCCGAGGCCAACCTGGACATGGAG
TACGCCATGGCCATAGGCTATCCCACCCAAATCACCTACTACTCGACGGGCGGTCGCGGTATCAAGATCAACGAC
TCGGGCGAGCCCTTCCCCGAGGAGTATTCGGACAATGAGCCCTACCTGCAGATGGTCGAGTACATGCTGGCCCTG
CCGGATGACAAGCTGCCCCACGTCATCAGCATGTCGTACGCCGACGACGAGCTCTCGGTGCCCAGGCCGTACGCC
GAGCGTGTCTGCGGGCTGATGGGCATGCTGACGAACCGCGGCACGTCCATCATCGTGGCCTCGGGAGATGGCGGA
GCTAGGGGAGGCCGCAGCTCGTCGTGCCGGACCAACGACGGCTCCAACAAGGAGATCACCATGGCCACCTTCCCG
GGCTCCTGTCCGTGGGTGACGTCGGTCGGGGCGACGACCAACCAGGCCGTCCCTCAGGGCGCCTACTTCAGCACC
GGCGGCTTCTCCCAATGGTTCCGGCAACCGCCGTGGCAAAAGGAGGCCGTCGACACGTACGTCAGGGACCATCTC
AAGGGCTACATGCGCGGCTACTACAACCCGGGCATGCGCGCCATACCGGACATCTCGGCCGTCGGAACCCAGTTC
TCGACCATTGTCAGCGGCGTGCCCGTCGCCCTGGACGGCACCAGCGCCAGCGCGCCCGTCTTCGCCGCCATGATT
GCCCTCGTCAACGACGCTCGCCTGCGTCAGGGCAAGCGGGCGCTCGGATGGCTCAACAAGAAGCTGTACTCTCCC
GACGTGCGAAAGGTGCTCTCCGACATCACGCTGGGTACCAGTAAAGGCTGCCCCTTTGGCGGAAAAGAGCTCGGC
TGGCCGGCTGCCACGGGCTGGGACGCCATTACGGGGCTGGGCACGCCTGGTGAATTCGAACACTTCTTGTCCGTC
ATGGCCTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail