Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|6158
Gene name
Locationscaffold_525:7364..9351
Strand-
Gene length (bp)1987
Transcript length (bp)1731
Coding sequence length (bp)1728
Protein length (aa) 576

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00005 ABC_tran ABC transporter 2.0E-23 52 203
PF01061 ABC2_membrane ABC-2 type transporter 3.8E-20 351 547
PF19055 ABC2_membrane_7 ABC-2 type transporter 6.8E-08 233 311

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q8RXN0|AB11G_ARATH ABC transporter G family member 11 OS=Arabidopsis thaliana GN=ABCG11 PE=1 SV=1 15 536 3.0E-69
sp|Q9C8K2|AB12G_ARATH ABC transporter G family member 12 OS=Arabidopsis thaliana GN=ABCG12 PE=1 SV=1 30 505 3.0E-67
sp|Q9ZU35|AB7G_ARATH ABC transporter G family member 7 OS=Arabidopsis thaliana GN=ABCG7 PE=2 SV=1 30 546 3.0E-62
sp|Q8RWI9|AB15G_ARATH ABC transporter G family member 15 OS=Arabidopsis thaliana GN=ABCG15 PE=2 SV=2 1 505 6.0E-62
sp|Q54TV2|ABCG5_DICDI ABC transporter G family member 5 OS=Dictyostelium discoideum GN=abcG5 PE=3 SV=1 42 542 8.0E-62
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q8RXN0|AB11G_ARATH ABC transporter G family member 11 OS=Arabidopsis thaliana GN=ABCG11 PE=1 SV=1 15 536 3.0E-69
sp|Q9C8K2|AB12G_ARATH ABC transporter G family member 12 OS=Arabidopsis thaliana GN=ABCG12 PE=1 SV=1 30 505 3.0E-67
sp|Q9ZU35|AB7G_ARATH ABC transporter G family member 7 OS=Arabidopsis thaliana GN=ABCG7 PE=2 SV=1 30 546 3.0E-62
sp|Q8RWI9|AB15G_ARATH ABC transporter G family member 15 OS=Arabidopsis thaliana GN=ABCG15 PE=2 SV=2 1 505 6.0E-62
sp|Q54TV2|ABCG5_DICDI ABC transporter G family member 5 OS=Dictyostelium discoideum GN=abcG5 PE=3 SV=1 42 542 8.0E-62
sp|Q54TV1|ABCG6_DICDI ABC transporter G family member 6 OS=Dictyostelium discoideum GN=abcG6 PE=3 SV=1 42 542 2.0E-61
sp|Q9C8J8|AB13G_ARATH ABC transporter G family member 13 OS=Arabidopsis thaliana GN=ABCG13 PE=2 SV=1 30 528 5.0E-60
sp|Q8T690|ABCG3_DICDI ABC transporter G family member 3 OS=Dictyostelium discoideum GN=abcG3 PE=3 SV=1 41 536 3.0E-57
sp|Q11180|WHT1_CAEEL ABC transporter ATP-binding protein/permease wht-1 OS=Caenorhabditis elegans GN=wht-1 PE=2 SV=2 48 547 7.0E-57
sp|P45843|SCRT_DROME Protein scarlet OS=Drosophila melanogaster GN=st PE=1 SV=3 30 542 3.0E-56
sp|Q8T689|ABCG4_DICDI ABC transporter G family member 4 OS=Dictyostelium discoideum GN=abcG4 PE=3 SV=1 50 534 2.0E-53
sp|P41820|BFR1_SCHPO Brefeldin A resistance protein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=bfr1 PE=1 SV=1 2 538 2.0E-53
sp|Q9M2V5|AB18G_ARATH ABC transporter G family member 18 OS=Arabidopsis thaliana GN=ABCG18 PE=2 SV=1 42 538 4.0E-53
sp|Q8T685|ABCGC_DICDI ABC transporter G family member 12 OS=Dictyostelium discoideum GN=abcG12 PE=3 SV=1 50 402 9.0E-53
sp|Q9M2V6|AB17G_ARATH ABC transporter G family member 17 OS=Arabidopsis thaliana GN=ABCG17 PE=2 SV=1 9 538 2.0E-52
sp|Q5MB13|ABCG2_MACMU ATP-binding cassette sub-family G member 2 OS=Macaca mulatta GN=ABCG2 PE=2 SV=1 29 537 5.0E-52
sp|Q9NGP5|ABCG2_DICDI ABC transporter G family member 2 OS=Dictyostelium discoideum GN=abcG2 PE=1 SV=2 30 536 5.0E-52
sp|Q9M3D6|AB19G_ARATH ABC transporter G family member 19 OS=Arabidopsis thaliana GN=ABCG19 PE=1 SV=1 37 542 1.0E-51
sp|Q9ZUU9|AB3G_ARATH ABC transporter G family member 3 OS=Arabidopsis thaliana GN=ABCG3 PE=1 SV=2 29 503 2.0E-51
sp|Q55DA0|ABCGM_DICDI ABC transporter G family member 22 OS=Dictyostelium discoideum GN=abcG22 PE=2 SV=1 26 398 4.0E-51
sp|Q80W57|ABCG2_RAT ATP-binding cassette sub-family G member 2 OS=Rattus norvegicus GN=Abcg2 PE=1 SV=1 30 534 7.0E-51
sp|B8ALI0|AB5G_ORYSI ABC transporter G family member 5 OS=Oryza sativa subsp. indica GN=OsI_11044 PE=3 SV=1 48 538 8.0E-51
sp|Q27256|WHITE_ANOGA Protein white OS=Anopheles gambiae GN=w PE=2 SV=1 47 547 9.0E-51
sp|Q9UNQ0|ABCG2_HUMAN ATP-binding cassette sub-family G member 2 OS=Homo sapiens GN=ABCG2 PE=1 SV=3 47 537 2.0E-50
sp|Q8H8V7|AB5G_ORYSJ ABC transporter G family member 5 OS=Oryza sativa subsp. japonica GN=RCN1 PE=1 SV=1 48 538 2.0E-50
sp|Q3E9B8|AB23G_ARATH ABC transporter G family member 23 OS=Arabidopsis thaliana GN=ABCG23 PE=2 SV=1 50 566 4.0E-50
sp|Q86HQ2|ABCG8_DICDI ABC transporter G family member 8 OS=Dictyostelium discoideum GN=abcG8 PE=3 SV=1 50 402 5.0E-50
sp|Q8T686|ABCG7_DICDI ABC transporter G family member 7 OS=Dictyostelium discoideum GN=abcG7 PE=3 SV=1 50 469 1.0E-49
sp|O42690|CDR3_CANAX Opaque-specific ABC transporter CDR3 OS=Candida albicans GN=CDR3 PE=2 SV=1 1 545 1.0E-49
sp|Q9MAH4|AB10G_ARATH ABC transporter G family member 10 OS=Arabidopsis thaliana GN=ABCG10 PE=3 SV=1 48 566 1.0E-49
sp|Q9SZR9|AB9G_ARATH ABC transporter G family member 9 OS=Arabidopsis thaliana GN=ABCG9 PE=3 SV=2 36 473 2.0E-49
sp|Q09466|WHT3_CAEEL ABC transporter ATP-binding protein/permease wht-3 OS=Caenorhabditis elegans GN=wht-3 PE=3 SV=1 30 526 2.0E-49
sp|P33302|PDR5_YEAST Pleiotropic ABC efflux transporter of multiple drugs OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PDR5 PE=1 SV=1 32 559 5.0E-49
sp|P32568|SNQ2_YEAST Protein SNQ2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SNQ2 PE=1 SV=2 2 549 7.0E-49
sp|Q7TMS5|ABCG2_MOUSE ATP-binding cassette sub-family G member 2 OS=Mus musculus GN=Abcg2 PE=1 SV=1 30 516 1.0E-48
sp|Q9ZUT0|AB2G_ARATH ABC transporter G family member 2 OS=Arabidopsis thaliana GN=ABCG2 PE=2 SV=1 48 538 1.0E-48
sp|Q04182|PDR15_YEAST ATP-dependent permease PDR15 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PDR15 PE=1 SV=1 32 574 1.0E-48
sp|Q99PE7|ABCG5_RAT ATP-binding cassette sub-family G member 5 OS=Rattus norvegicus GN=Abcg5 PE=2 SV=3 48 472 2.0E-48
sp|Q9M2V7|AB16G_ARATH ABC transporter G family member 16 OS=Arabidopsis thaliana GN=ABCG16 PE=2 SV=2 48 538 3.0E-48
sp|Q93YS4|AB22G_ARATH ABC transporter G family member 22 OS=Arabidopsis thaliana GN=ABCG22 PE=1 SV=1 30 530 5.0E-48
sp|Q55GB1|ABCGF_DICDI ABC transporter G family member 15 OS=Dictyostelium discoideum GN=abcG15 PE=3 SV=1 44 559 8.0E-48
sp|Q9LFG8|AB20G_ARATH ABC transporter G family member 20 OS=Arabidopsis thaliana GN=ABCG20 PE=2 SV=1 48 538 2.0E-47
sp|Q99PE8|ABCG5_MOUSE ATP-binding cassette sub-family G member 5 OS=Mus musculus GN=Abcg5 PE=1 SV=1 48 472 3.0E-47
sp|Q8MIB3|ABCG2_PIG ATP-binding cassette sub-family G member 2 OS=Sus scrofa GN=ABCG2 PE=2 SV=1 47 537 4.0E-47
sp|Q4GZT4|ABCG2_BOVIN ATP-binding cassette sub-family G member 2 OS=Bos taurus GN=ABCG2 PE=3 SV=2 47 534 4.0E-47
sp|Q9H222|ABCG5_HUMAN ATP-binding cassette sub-family G member 5 OS=Homo sapiens GN=ABCG5 PE=1 SV=1 48 528 5.0E-47
sp|P10090|WHITE_DROME Protein white OS=Drosophila melanogaster GN=w PE=2 SV=2 45 490 7.0E-47
sp|Q9SW08|AB4G_ARATH ABC transporter G family member 4 OS=Arabidopsis thaliana GN=ABCG4 PE=3 SV=1 50 538 7.0E-47
sp|Q9SIT6|AB5G_ARATH ABC transporter G family member 5 OS=Arabidopsis thaliana GN=ABCG5 PE=2 SV=1 36 550 1.0E-46
sp|B9GDE5|AB50G_ORYSJ ABC transporter G family member 50 OS=Oryza sativa subsp. japonica GN=ABCG50 PE=2 SV=2 47 575 1.0E-46
sp|P53756|PDR18_YEAST ABC transporter ATP-binding protein/permease PDR18 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PDR18 PE=3 SV=1 32 555 2.0E-46
sp|Q05360|WHITE_LUCCU Protein white OS=Lucilia cuprina GN=W PE=2 SV=2 47 539 2.0E-46
sp|Q08234|YO075_YEAST Uncharacterized ABC transporter ATP-binding protein/permease YOL075C OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YOL075C PE=1 SV=3 45 503 2.0E-46
sp|P51533|PDR10_YEAST ATP-dependent permease PDR10 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PDR10 PE=3 SV=1 32 545 5.0E-46
sp|Q9H172|ABCG4_HUMAN ATP-binding cassette sub-family G member 4 OS=Homo sapiens GN=ABCG4 PE=1 SV=2 2 471 5.0E-46
sp|Q08234|YO075_YEAST Uncharacterized ABC transporter ATP-binding protein/permease YOL075C OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YOL075C PE=1 SV=3 10 476 6.0E-46
sp|Q7PC88|AB31G_ARATH ABC transporter G family member 31 OS=Arabidopsis thaliana GN=ABCG31 PE=1 SV=1 46 530 6.0E-46
sp|O80946|AB1G_ARATH ABC transporter G family member 1 OS=Arabidopsis thaliana GN=ABCG1 PE=2 SV=1 48 538 8.0E-46
sp|Q9FLX5|AB8G_ARATH ABC transporter G family member 8 OS=Arabidopsis thaliana GN=ABCG8 PE=2 SV=1 50 538 9.0E-46
sp|Q9ZUT8|AB33G_ARATH ABC transporter G family member 33 OS=Arabidopsis thaliana GN=ABCG33 PE=2 SV=1 35 575 1.0E-45
sp|O74676|CDR4_CANAX ABC transporter CDR4 OS=Candida albicans GN=CDR4 PE=3 SV=1 16 574 2.0E-45
sp|Q6YW62|AB44G_ORYSJ ABC transporter G family member 44 OS=Oryza sativa subsp. japonica GN=ABCG44 PE=2 SV=2 50 539 2.0E-45
sp|Q556W2|ABCGH_DICDI ABC transporter G family member 17 OS=Dictyostelium discoideum GN=abcG17-1 PE=3 SV=1 11 539 6.0E-45
sp|O81016|AB32G_ARATH ABC transporter G family member 32 OS=Arabidopsis thaliana GN=ABCG32 PE=1 SV=1 47 545 1.0E-44
sp|Q9C6W5|AB14G_ARATH ABC transporter G family member 14 OS=Arabidopsis thaliana GN=ABCG14 PE=2 SV=1 41 290 1.0E-44
sp|Q17320|WHITE_CERCA Protein white OS=Ceratitis capitata GN=W PE=2 SV=1 31 547 1.0E-44
sp|Q9FT51|AB27G_ARATH ABC transporter G family member 27 OS=Arabidopsis thaliana GN=ABCG27 PE=2 SV=1 37 290 1.0E-44
sp|Q55DW4|ABCG1_DICDI ABC transporter G family member 1 OS=Dictyostelium discoideum GN=abcG1 PE=3 SV=1 50 291 1.0E-44
sp|Q16928|WHITE_ANOAL Protein white OS=Anopheles albimanus GN=W PE=3 SV=1 47 547 1.0E-44
sp|Q54T02|ABCGO_DICDI ABC transporter G family member 24 OS=Dictyostelium discoideum GN=abcG24 PE=3 SV=1 18 290 2.0E-44
sp|Q55DR1|ABCGE_DICDI ABC transporter G family member 14 OS=Dictyostelium discoideum GN=abcG14 PE=3 SV=1 30 540 2.0E-44
sp|Q8T673|ABCGL_DICDI ABC transporter G family member 21 OS=Dictyostelium discoideum GN=abcG21 PE=3 SV=1 30 540 2.0E-44
sp|Q9XIE2|AB36G_ARATH ABC transporter G family member 36 OS=Arabidopsis thaliana GN=ABCG36 PE=1 SV=1 46 538 3.0E-44
sp|Q8GZ52|AB30G_ARATH ABC transporter G family member 30 OS=Arabidopsis thaliana GN=ABCG30 PE=2 SV=2 29 538 4.0E-44
sp|Q8T675|ABCGJ_DICDI ABC transporter G family member 19 OS=Dictyostelium discoideum GN=abcG19 PE=3 SV=1 11 540 8.0E-44
sp|P78595|CDR2_CANAL Multidrug resistance protein CDR2 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=CDR2 PE=3 SV=2 32 547 1.0E-43
sp|O74208|PDH1_CANGA ATP-binding cassette transporter CGR1 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=PDH1 PE=3 SV=3 48 545 2.0E-43
sp|Q64343|ABCG1_MOUSE ATP-binding cassette sub-family G member 1 OS=Mus musculus GN=Abcg1 PE=1 SV=1 43 372 5.0E-43
sp|P43071|CDR1_CANAX Multidrug resistance protein CDR1 OS=Candida albicans GN=CDR1 PE=3 SV=1 32 574 8.0E-43
sp|Q84TH5|AB25G_ARATH ABC transporter G family member 25 OS=Arabidopsis thaliana GN=ABCG25 PE=2 SV=1 43 530 9.0E-43
sp|B9G300|AB52G_ORYSJ ABC transporter G family member 52 OS=Oryza sativa subsp. japonica GN=ABCG52 PE=2 SV=2 47 529 1.0E-42
sp|Q5ANA3|CDR1_CANAL Pleiotropic ABC efflux transporter of multiple drugs CDR1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=CDR1 PE=1 SV=1 32 574 1.0E-42
sp|P45844|ABCG1_HUMAN ATP-binding cassette sub-family G member 1 OS=Homo sapiens GN=ABCG1 PE=1 SV=3 29 320 2.0E-42
sp|Q7XA72|AB21G_ARATH ABC transporter G family member 21 OS=Arabidopsis thaliana GN=ABCG21 PE=2 SV=2 50 530 5.0E-42
sp|Q8T683|ABCG9_DICDI ABC transporter G family member 9 OS=Dictyostelium discoideum GN=abcG9 PE=3 SV=1 44 540 5.0E-42
sp|Q8GU89|AB37G_ORYSJ ABC transporter G family member 37 OS=Oryza sativa subsp. japonica GN=ABCG37 PE=2 SV=1 50 539 6.0E-42
sp|Q9FNB5|AB6G_ARATH ABC transporter G family member 6 OS=Arabidopsis thaliana GN=ABCG6 PE=2 SV=1 48 538 7.0E-42
sp|Q76CU2|PDR1_TOBAC Pleiotropic drug resistance protein 1 OS=Nicotiana tabacum GN=PDR1 PE=2 SV=1 44 545 9.0E-42
sp|Q6EQ60|AB47G_ORYSJ ABC transporter G family member 47 OS=Oryza sativa subsp. japonica GN=ABCG47 PE=3 SV=2 7 559 9.0E-42
sp|D4AYW0|ABCG1_ARTBC ABC transporter G family member ARB_01379 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_01379 PE=1 SV=1 48 327 2.0E-41
sp|Q2QV81|AB49G_ORYSJ ABC transporter G family member 49 OS=Oryza sativa subsp. japonica GN=ABCG49 PE=2 SV=3 40 538 2.0E-41
sp|Q55DQ2|ABCGB_DICDI ABC transporter G family member 11 OS=Dictyostelium discoideum GN=abcG11 PE=3 SV=1 32 574 2.0E-41
sp|Q7PC86|AB35G_ARATH ABC transporter G family member 35 OS=Arabidopsis thaliana GN=ABCG35 PE=2 SV=1 46 538 2.0E-41
sp|Q9LK50|AB26G_ARATH ABC transporter G family member 26 OS=Arabidopsis thaliana GN=ABCG26 PE=3 SV=2 48 530 2.0E-41
sp|Q9LFH0|AB37G_ARATH ABC transporter G family member 37 OS=Arabidopsis thaliana GN=ABCG37 PE=2 SV=1 1 564 3.0E-41
sp|Q54TV1|ABCG6_DICDI ABC transporter G family member 6 OS=Dictyostelium discoideum GN=abcG6 PE=3 SV=1 33 538 4.0E-41
sp|Q7PC88|AB31G_ARATH ABC transporter G family member 31 OS=Arabidopsis thaliana GN=ABCG31 PE=1 SV=1 39 545 7.0E-41
sp|Q7PC82|AB42G_ARATH ABC transporter G family member 42 OS=Arabidopsis thaliana GN=ABCG42 PE=2 SV=1 45 532 8.0E-41
sp|Q8LQX2|AB32G_ORYSJ ABC transporter G family member 32 OS=Oryza sativa subsp. japonica GN=ABCG32 PE=2 SV=1 50 529 1.0E-40
sp|Q54CG0|ABCGA_DICDI ABC transporter G family member 10 OS=Dictyostelium discoideum GN=abcG10 PE=3 SV=1 50 574 1.0E-40
sp|Q54HM0|ABCGG_DICDI ABC transporter G family member 16 OS=Dictyostelium discoideum GN=abcG16 PE=3 SV=1 5 539 1.0E-40
sp|Q02785|PDR12_YEAST ATP-dependent permease PDR12 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PDR12 PE=1 SV=1 44 370 1.0E-40
sp|Q9DBM0|ABCG8_MOUSE ATP-binding cassette sub-family G member 8 OS=Mus musculus GN=Abcg8 PE=2 SV=1 51 505 1.0E-40
sp|Q8ST66|ABCGI_DICDI ABC transporter G family member 18 OS=Dictyostelium discoideum GN=abcG18 PE=3 SV=1 11 288 2.0E-40
sp|A3BXL8|AB53G_ORYSJ ABC transporter G family member 53 OS=Oryza sativa subsp. japonica GN=ABCG53 PE=2 SV=1 3 550 2.0E-40
sp|Q7PC83|AB41G_ARATH ABC transporter G family member 41 OS=Arabidopsis thaliana GN=ABCG41 PE=2 SV=1 29 538 2.0E-40
sp|Q8GU82|AB45G_ORYSJ ABC transporter G family member 45 OS=Oryza sativa subsp. japonica GN=ABCG45 PE=2 SV=2 49 545 3.0E-40
sp|Q7PC81|AB43G_ARATH ABC transporter G family member 43 OS=Arabidopsis thaliana GN=ABCG43 PE=3 SV=1 45 532 4.0E-40
sp|Q8GU86|AB43G_ORYSJ ABC transporter G family member 43 OS=Oryza sativa subsp. japonica GN=ABCG43 PE=2 SV=2 46 514 4.0E-40
sp|Q54TV2|ABCG5_DICDI ABC transporter G family member 5 OS=Dictyostelium discoideum GN=abcG5 PE=3 SV=1 33 538 5.0E-40
sp|Q9NGP5|ABCG2_DICDI ABC transporter G family member 2 OS=Dictyostelium discoideum GN=abcG2 PE=1 SV=2 33 538 5.0E-40
sp|Q9LFH0|AB37G_ARATH ABC transporter G family member 37 OS=Arabidopsis thaliana GN=ABCG37 PE=2 SV=1 49 533 5.0E-40
sp|Q7FMW4|AB38G_ORYSJ ABC transporter G family member 38 OS=Oryza sativa subsp. japonica GN=ABCG38 PE=3 SV=1 45 538 5.0E-40
sp|Q7PC85|AB38G_ARATH ABC transporter G family member 38 OS=Arabidopsis thaliana GN=ABCG38 PE=2 SV=1 26 515 5.0E-40
sp|Q08409|AUS1_YEAST ATP-dependent permease AUS1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=AUS1 PE=3 SV=1 11 558 5.0E-40
sp|Q9H221|ABCG8_HUMAN ATP-binding cassette sub-family G member 8 OS=Homo sapiens GN=ABCG8 PE=1 SV=1 51 491 6.0E-40
sp|Q9MAG3|AB24G_ARATH ABC transporter G family member 24 OS=Arabidopsis thaliana GN=ABCG24 PE=2 SV=2 16 289 7.0E-40
sp|Q94A18|AB29G_ARATH ABC transporter G family member 29 OS=Arabidopsis thaliana GN=ABCG29 PE=2 SV=2 5 538 7.0E-40
sp|Q8GU88|AB39G_ORYSJ ABC transporter G family member 39 OS=Oryza sativa subsp. japonica GN=ABCG39 PE=3 SV=1 50 529 8.0E-40
sp|Q9ZUT8|AB33G_ARATH ABC transporter G family member 33 OS=Arabidopsis thaliana GN=ABCG33 PE=2 SV=1 42 471 1.0E-39
sp|Q8GU84|AB48G_ORYSJ ABC transporter G family member 48 OS=Oryza sativa subsp. japonica GN=ABCG48 PE=3 SV=1 46 545 1.0E-39
sp|Q5W274|PDR3_TOBAC Pleiotropic drug resistance protein 3 OS=Nicotiana tabacum GN=PDR3 PE=2 SV=1 46 566 1.0E-39
sp|Q7PC81|AB43G_ARATH ABC transporter G family member 43 OS=Arabidopsis thaliana GN=ABCG43 PE=3 SV=1 43 575 2.0E-39
sp|Q5W274|PDR3_TOBAC Pleiotropic drug resistance protein 3 OS=Nicotiana tabacum GN=PDR3 PE=2 SV=1 47 538 2.0E-39
sp|Q9M9E1|AB40G_ARATH ABC transporter G family member 40 OS=Arabidopsis thaliana GN=ABCG40 PE=1 SV=1 47 542 3.0E-39
sp|P25371|ADP1_YEAST Probable ATP-dependent permease OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ADP1 PE=1 SV=2 1 292 4.0E-39
sp|Q9SJK6|WBC30_ARATH Putative white-brown complex homolog protein 30 OS=Arabidopsis thaliana GN=WBC30 PE=1 SV=3 27 304 1.0E-38
sp|P58428|ABCG8_RAT ATP-binding cassette sub-family G member 8 OS=Rattus norvegicus GN=Abcg8 PE=2 SV=2 51 534 1.0E-38
sp|Q2QV81|AB49G_ORYSJ ABC transporter G family member 49 OS=Oryza sativa subsp. japonica GN=ABCG49 PE=2 SV=3 46 564 2.0E-38
sp|Q7PC84|AB39G_ARATH ABC transporter G family member 39 OS=Arabidopsis thaliana GN=ABCG39 PE=3 SV=1 45 545 2.0E-38
sp|Q8GU87|AB31G_ORYSJ ABC transporter G family member 31 OS=Oryza sativa subsp. japonica GN=ABCG31 PE=2 SV=3 47 545 2.0E-38
sp|Q54HM0|ABCGG_DICDI ABC transporter G family member 16 OS=Dictyostelium discoideum GN=abcG16 PE=3 SV=1 26 295 4.0E-38
sp|Q7PC87|AB34G_ARATH ABC transporter G family member 34 OS=Arabidopsis thaliana GN=ABCG34 PE=2 SV=1 45 545 4.0E-38
sp|Q8GZ52|AB30G_ARATH ABC transporter G family member 30 OS=Arabidopsis thaliana GN=ABCG30 PE=2 SV=2 43 564 5.0E-38
sp|Q5Z9S8|AB42G_ORYSJ ABC transporter G family member 42 OS=Oryza sativa subsp. japonica GN=ABCG42 PE=2 SV=1 47 538 5.0E-38
sp|Q8GU83|AB41G_ORYSJ ABC transporter G family member 41 OS=Oryza sativa subsp. japonica GN=ABCG41 PE=3 SV=1 49 538 6.0E-38
sp|C7J6G6|AB46G_ORYSJ ABC transporter G family member 46 OS=Oryza sativa subsp. japonica GN=ABCG46 PE=3 SV=2 37 471 6.0E-38
sp|Q0JLC5|AB36G_ORYSJ ABC transporter G family member 36 OS=Oryza sativa subsp. japonica GN=ABCG36 PE=2 SV=1 5 529 7.0E-38
sp|Q8GU87|AB31G_ORYSJ ABC transporter G family member 31 OS=Oryza sativa subsp. japonica GN=ABCG31 PE=2 SV=3 42 473 9.0E-38
sp|A2WSH0|AB36G_ORYSI ABC transporter G family member 36 OS=Oryza sativa subsp. indica GN=ABCG36 PE=2 SV=1 5 529 9.0E-38
sp|Q8GU85|AB40G_ORYSJ ABC transporter G family member 40 OS=Oryza sativa subsp. japonica GN=ABCG40 PE=3 SV=2 46 545 1.0E-37
sp|O24367|TUR2_SPIPO Pleiotropic drug resistance protein TUR2 OS=Spirodela polyrhiza GN=TUR2 PE=1 SV=1 50 476 2.0E-37
sp|Q8S628|AB51G_ORYSJ ABC transporter G family member 51 OS=Oryza sativa subsp. japonica GN=ABCG51 PE=3 SV=1 7 550 3.0E-37
sp|Q7PC82|AB42G_ARATH ABC transporter G family member 42 OS=Arabidopsis thaliana GN=ABCG42 PE=2 SV=1 45 564 4.0E-37
sp|Q7PC80|AB34G_ORYSJ ABC transporter G family member 34 OS=Oryza sativa subsp. japonica GN=ABCG34 PE=3 SV=1 47 473 2.0E-36
sp|P40550|PDR11_YEAST ATP-dependent permease PDR11 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PDR11 PE=1 SV=3 30 555 3.0E-36
sp|Q8ST66|ABCGI_DICDI ABC transporter G family member 18 OS=Dictyostelium discoideum GN=abcG18 PE=3 SV=1 44 289 4.0E-36
sp|Q8S628|AB51G_ORYSJ ABC transporter G family member 51 OS=Oryza sativa subsp. japonica GN=ABCG51 PE=3 SV=1 47 576 7.0E-36
sp|Q949G3|PDR1_NICPL Pleiotropic drug resistance protein 1 OS=Nicotiana plumbaginifolia GN=PDR1 PE=1 SV=1 46 529 7.0E-36
sp|Q8GU83|AB41G_ORYSJ ABC transporter G family member 41 OS=Oryza sativa subsp. japonica GN=ABCG41 PE=3 SV=1 42 564 8.0E-36
sp|Q8GU92|AB35G_ORYSJ ABC transporter G family member 35 OS=Oryza sativa subsp. japonica GN=ABCG35 PE=3 SV=1 47 476 8.0E-36
sp|Q2PCF1|PDR2_NICPL Pleiotropic drug resistance protein 2 OS=Nicotiana plumbaginifolia GN=PDR2 PE=2 SV=1 47 545 1.0E-35
sp|Q8GU88|AB39G_ORYSJ ABC transporter G family member 39 OS=Oryza sativa subsp. japonica GN=ABCG39 PE=3 SV=1 49 553 2.0E-34
sp|Q5Z9S8|AB42G_ORYSJ ABC transporter G family member 42 OS=Oryza sativa subsp. japonica GN=ABCG42 PE=2 SV=1 25 545 2.0E-34
sp|O24367|TUR2_SPIPO Pleiotropic drug resistance protein TUR2 OS=Spirodela polyrhiza GN=TUR2 PE=1 SV=1 49 553 2.0E-34
sp|B9GDE5|AB50G_ORYSJ ABC transporter G family member 50 OS=Oryza sativa subsp. japonica GN=ABCG50 PE=2 SV=2 46 532 4.0E-34
sp|Q6EQ60|AB47G_ORYSJ ABC transporter G family member 47 OS=Oryza sativa subsp. japonica GN=ABCG47 PE=3 SV=2 42 503 1.0E-33
sp|Q7FMW4|AB38G_ORYSJ ABC transporter G family member 38 OS=Oryza sativa subsp. japonica GN=ABCG38 PE=3 SV=1 37 545 3.0E-33
sp|Q99P81|ABCG3_MOUSE ATP-binding cassette sub-family G member 3 OS=Mus musculus GN=Abcg3 PE=1 SV=2 42 526 3.0E-33
sp|Q7PC83|AB41G_ARATH ABC transporter G family member 41 OS=Arabidopsis thaliana GN=ABCG41 PE=2 SV=1 43 471 2.0E-32
sp|Q94A18|AB29G_ARATH ABC transporter G family member 29 OS=Arabidopsis thaliana GN=ABCG29 PE=2 SV=2 29 472 2.0E-32
sp|Q8GU84|AB48G_ORYSJ ABC transporter G family member 48 OS=Oryza sativa subsp. japonica GN=ABCG48 PE=3 SV=1 41 545 2.0E-32
sp|Q9M9E1|AB40G_ARATH ABC transporter G family member 40 OS=Arabidopsis thaliana GN=ABCG40 PE=1 SV=1 50 538 4.0E-32
sp|Q9FF46|AB28G_ARATH ABC transporter G family member 28 OS=Arabidopsis thaliana GN=ABCG28 PE=3 SV=1 30 302 7.0E-32
sp|Q949G3|PDR1_NICPL Pleiotropic drug resistance protein 1 OS=Nicotiana plumbaginifolia GN=PDR1 PE=1 SV=1 50 475 2.0E-31
sp|O81016|AB32G_ARATH ABC transporter G family member 32 OS=Arabidopsis thaliana GN=ABCG32 PE=1 SV=1 36 473 3.0E-31
sp|Q8GU92|AB35G_ORYSJ ABC transporter G family member 35 OS=Oryza sativa subsp. japonica GN=ABCG35 PE=3 SV=1 50 538 3.0E-31
sp|Q8GU82|AB45G_ORYSJ ABC transporter G family member 45 OS=Oryza sativa subsp. japonica GN=ABCG45 PE=2 SV=2 49 547 1.0E-30
sp|Q8GU86|AB43G_ORYSJ ABC transporter G family member 43 OS=Oryza sativa subsp. japonica GN=ABCG43 PE=2 SV=2 49 567 1.0E-30
sp|Q9C0Y5|PDR1_SCHPO ATP-binding cassette transporter pdr1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pdr1 PE=3 SV=1 4 409 1.0E-30
sp|Q9XIE2|AB36G_ARATH ABC transporter G family member 36 OS=Arabidopsis thaliana GN=ABCG36 PE=1 SV=1 50 488 2.0E-30
sp|Q8GU85|AB40G_ORYSJ ABC transporter G family member 40 OS=Oryza sativa subsp. japonica GN=ABCG40 PE=3 SV=2 41 545 3.0E-30
sp|Q2PCF1|PDR2_NICPL Pleiotropic drug resistance protein 2 OS=Nicotiana plumbaginifolia GN=PDR2 PE=2 SV=1 22 290 4.0E-30
sp|A3BXL8|AB53G_ORYSJ ABC transporter G family member 53 OS=Oryza sativa subsp. japonica GN=ABCG53 PE=2 SV=1 49 473 5.0E-30
sp|Q7PC85|AB38G_ARATH ABC transporter G family member 38 OS=Arabidopsis thaliana GN=ABCG38 PE=2 SV=1 22 553 6.0E-30
sp|Q7PC87|AB34G_ARATH ABC transporter G family member 34 OS=Arabidopsis thaliana GN=ABCG34 PE=2 SV=1 50 541 1.0E-29
sp|B9G300|AB52G_ORYSJ ABC transporter G family member 52 OS=Oryza sativa subsp. japonica GN=ABCG52 PE=2 SV=2 42 473 3.0E-29
sp|Q7PC84|AB39G_ARATH ABC transporter G family member 39 OS=Arabidopsis thaliana GN=ABCG39 PE=3 SV=1 49 290 4.0E-29
sp|Q7PC86|AB35G_ARATH ABC transporter G family member 35 OS=Arabidopsis thaliana GN=ABCG35 PE=2 SV=1 49 290 8.0E-29
sp|Q0JLC5|AB36G_ORYSJ ABC transporter G family member 36 OS=Oryza sativa subsp. japonica GN=ABCG36 PE=2 SV=1 50 538 1.0E-28
sp|Q8T690|ABCG3_DICDI ABC transporter G family member 3 OS=Dictyostelium discoideum GN=abcG3 PE=3 SV=1 46 288 2.0E-28
sp|Q8GU89|AB37G_ORYSJ ABC transporter G family member 37 OS=Oryza sativa subsp. japonica GN=ABCG37 PE=2 SV=1 49 475 2.0E-28
sp|Q76CU2|PDR1_TOBAC Pleiotropic drug resistance protein 1 OS=Nicotiana tabacum GN=PDR1 PE=2 SV=1 45 538 4.0E-28
sp|Q7PC80|AB34G_ORYSJ ABC transporter G family member 34 OS=Oryza sativa subsp. japonica GN=ABCG34 PE=3 SV=1 50 538 4.0E-28
sp|A2WSH0|AB36G_ORYSI ABC transporter G family member 36 OS=Oryza sativa subsp. indica GN=ABCG36 PE=2 SV=1 50 538 9.0E-28
sp|Q8LQX2|AB32G_ORYSJ ABC transporter G family member 32 OS=Oryza sativa subsp. japonica GN=ABCG32 PE=2 SV=1 49 473 2.0E-26
sp|Q6YW62|AB44G_ORYSJ ABC transporter G family member 44 OS=Oryza sativa subsp. japonica GN=ABCG44 PE=2 SV=2 49 290 5.0E-26
sp|P41820|BFR1_SCHPO Brefeldin A resistance protein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=bfr1 PE=1 SV=1 42 550 1.0E-25
sp|Q8SQU5|YBD4_ENCCU ABC transporter-like protein ECU11_1340 OS=Encephalitozoon cuniculi (strain GB-M1) GN=ECU11_1340 PE=1 SV=1 33 292 3.0E-25
sp|Q556W2|ABCGH_DICDI ABC transporter G family member 17 OS=Dictyostelium discoideum GN=abcG17-1 PE=3 SV=1 49 550 1.0E-23
sp|Q24739|BROWN_DROVI Protein brown OS=Drosophila virilis GN=bw PE=2 SV=1 49 221 1.0E-23
sp|P78595|CDR2_CANAL Multidrug resistance protein CDR2 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=CDR2 PE=3 SV=2 26 529 3.0E-23
sp|Q04182|PDR15_YEAST ATP-dependent permease PDR15 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PDR15 PE=1 SV=1 24 500 4.0E-23
sp|Q08409|AUS1_YEAST ATP-dependent permease AUS1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=AUS1 PE=3 SV=1 113 476 6.0E-23
sp|Q55GB1|ABCGF_DICDI ABC transporter G family member 15 OS=Dictyostelium discoideum GN=abcG15 PE=3 SV=1 49 315 7.0E-23
sp|P12428|BROWN_DROME Protein brown OS=Drosophila melanogaster GN=bw PE=2 SV=1 50 221 7.0E-23
sp|Q82WT5|CYSA_NITEU Sulfate/thiosulfate import ATP-binding protein CysA OS=Nitrosomonas europaea (strain ATCC 19718 / NBRC 14298) GN=cysA PE=3 SV=1 58 265 2.0E-22
sp|Q8T683|ABCG9_DICDI ABC transporter G family member 9 OS=Dictyostelium discoideum GN=abcG9 PE=3 SV=1 49 321 3.0E-22
sp|Q58903|Y1508_METJA Uncharacterized ABC transporter ATP-binding protein MJ1508 OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=MJ1508 PE=3 SV=1 43 246 3.0E-22
sp|Q9YG51|PSTB_AERPE Phosphate import ATP-binding protein PstB OS=Aeropyrum pernix (strain ATCC 700893 / DSM 11879 / JCM 9820 / NBRC 100138 / K1) GN=pstB PE=3 SV=1 48 264 4.0E-22
sp|Q8E8K8|CYSA2_SHEON Sulfate/thiosulfate import ATP-binding protein CysA 2 OS=Shewanella oneidensis (strain MR-1) GN=cysA2 PE=3 SV=1 51 273 4.0E-22
sp|Q55DR1|ABCGE_DICDI ABC transporter G family member 14 OS=Dictyostelium discoideum GN=abcG14 PE=3 SV=1 43 315 2.0E-21
sp|Q89UD2|CYSA_BRADU Sulfate/thiosulfate import ATP-binding protein CysA OS=Bradyrhizobium diazoefficiens (strain JCM 10833 / IAM 13628 / NBRC 14792 / USDA 110) GN=cysA PE=3 SV=1 51 265 2.0E-21
sp|P32568|SNQ2_YEAST Protein SNQ2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SNQ2 PE=1 SV=2 8 285 4.0E-21
sp|Q02785|PDR12_YEAST ATP-dependent permease PDR12 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PDR12 PE=1 SV=1 48 320 4.0E-21
sp|Q6NBT1|CYSA_RHOPA Sulfate/thiosulfate import ATP-binding protein CysA OS=Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009) GN=cysA PE=3 SV=1 51 265 5.0E-21
sp|Q7WGW1|CYSA_BORBR Sulfate/thiosulfate import ATP-binding protein CysA OS=Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50) GN=cysA PE=3 SV=1 35 265 6.0E-21
sp|Q7NX01|CYSA1_CHRVO Sulfate/thiosulfate import ATP-binding protein CysA 1 OS=Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / NBRC 12614 / NCIMB 9131 / NCTC 9757) GN=cysA1 PE=3 SV=1 60 262 7.0E-21
sp|P53756|PDR18_YEAST ABC transporter ATP-binding protein/permease PDR18 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PDR18 PE=3 SV=1 12 522 8.0E-21
sp|Q93DX8|CYSA_BURCE Sulfate/thiosulfate import ATP-binding protein CysA (Fragment) OS=Burkholderia cepacia GN=cysA PE=3 SV=1 51 270 8.0E-21
sp|P51533|PDR10_YEAST ATP-dependent permease PDR10 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PDR10 PE=3 SV=1 30 385 9.0E-21
sp|Q8XZP8|CYSA_RALSO Sulfate/thiosulfate import ATP-binding protein CysA OS=Ralstonia solanacearum (strain GMI1000) GN=cysA PE=3 SV=1 51 264 9.0E-21
sp|Q55DQ2|ABCGB_DICDI ABC transporter G family member 11 OS=Dictyostelium discoideum GN=abcG11 PE=3 SV=1 43 376 1.0E-20
sp|Q88AS5|CYSA_PSESM Sulfate/thiosulfate import ATP-binding protein CysA OS=Pseudomonas syringae pv. tomato (strain DC3000) GN=cysA PE=3 SV=1 51 280 1.0E-20
sp|O65934|ABC1_MYCTU ABC transporter ATP-binding/permease protein Rv1747 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=Rv1747 PE=1 SV=1 19 261 1.0E-20
sp|Q9I6L0|CYSA_PSEAE Sulfate/thiosulfate import ATP-binding protein CysA OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=cysA PE=3 SV=1 51 265 2.0E-20
sp|O59479|Y1815_PYRHO Putative ABC transporter ATP-binding protein PH1815 OS=Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3) GN=PH1815 PE=3 SV=1 42 276 2.0E-20
sp|Q7VZE5|CYSA_BORPE Sulfate/thiosulfate import ATP-binding protein CysA OS=Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251) GN=cysA PE=3 SV=1 35 265 3.0E-20
sp|Q9G4F5|CYSA_CUCSA Sulfate/thiosulfate import ATP-binding protein cysA OS=Cucumis sativus GN=CYSA PE=3 SV=1 58 265 3.0E-20
sp|Q7W9U5|CYSA_BORPA Sulfate/thiosulfate import ATP-binding protein CysA OS=Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253) GN=cysA PE=3 SV=1 35 265 3.0E-20
sp|Q9V1Q4|Y373_PYRAB Putative ABC transporter ATP-binding protein PYRAB03730 OS=Pyrococcus abyssi (strain GE5 / Orsay) GN=PYRAB03730 PE=3 SV=1 44 276 3.0E-20
sp|Q5ANA3|CDR1_CANAL Pleiotropic ABC efflux transporter of multiple drugs CDR1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=CDR1 PE=1 SV=1 26 534 4.0E-20
sp|C7J6G6|AB46G_ORYSJ ABC transporter G family member 46 OS=Oryza sativa subsp. japonica GN=ABCG46 PE=3 SV=2 43 473 4.0E-20
sp|P43071|CDR1_CANAX Multidrug resistance protein CDR1 OS=Candida albicans GN=CDR1 PE=3 SV=1 26 534 5.0E-20
sp|Q7VM95|METN_HAEDU Methionine import ATP-binding protein MetN OS=Haemophilus ducreyi (strain 35000HP / ATCC 700724) GN=metN PE=3 SV=1 51 262 6.0E-20
sp|Q5UW69|PHNC2_HALMA Phosphonates import ATP-binding protein PhnC 2 OS=Haloarcula marismortui (strain ATCC 43049 / DSM 3752 / JCM 8966 / VKM B-1809) GN=phnC2 PE=3 SV=1 58 262 1.0E-19
sp|Q6D201|CYSA_PECAS Sulfate/thiosulfate import ATP-binding protein CysA OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) GN=cysA PE=3 SV=1 58 280 1.0E-19
sp|Q8T674|ABCGK_DICDI ABC transporter G family member 20 OS=Dictyostelium discoideum GN=abcG20 PE=3 SV=1 43 268 1.0E-19
sp|Q88CL2|CYSA_PSEPK Sulfate/thiosulfate import ATP-binding protein CysA OS=Pseudomonas putida (strain KT2440) GN=cysA PE=3 SV=1 58 280 2.0E-19
sp|Q8PSR0|Y3016_METMA Putative ABC transporter ATP-binding protein MM_3016 OS=Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88) GN=MM_3016 PE=3 SV=1 46 276 2.0E-19
sp|Q8D653|CYSA_VIBVU Sulfate/thiosulfate import ATP-binding protein CysA OS=Vibrio vulnificus (strain CMCP6) GN=cysA PE=3 SV=1 51 262 2.0E-19
sp|Q62K82|CYSA_BURMA Sulfate/thiosulfate import ATP-binding protein CysA OS=Burkholderia mallei (strain ATCC 23344) GN=cysA PE=3 SV=1 51 270 3.0E-19
sp|Q63TY1|CYSA_BURPS Sulfate/thiosulfate import ATP-binding protein CysA OS=Burkholderia pseudomallei (strain K96243) GN=cysA PE=3 SV=1 51 270 3.0E-19
sp|Q8T673|ABCGL_DICDI ABC transporter G family member 21 OS=Dictyostelium discoideum GN=abcG21 PE=3 SV=1 42 568 5.0E-19
sp|Q6WB63|PHNC_ALCFA Phosphonates import ATP-binding protein PhnC OS=Alcaligenes faecalis GN=phnC PE=3 SV=1 58 261 5.0E-19
sp|Q609Q1|CYSA_METCA Sulfate/thiosulfate import ATP-binding protein CysA OS=Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath) GN=cysA PE=3 SV=1 58 239 5.0E-19
sp|Q8T675|ABCGJ_DICDI ABC transporter G family member 19 OS=Dictyostelium discoideum GN=abcG19 PE=3 SV=1 42 320 6.0E-19
sp|O31339|CYSA_BACC1 Sulfate/thiosulfate import ATP-binding protein CysA OS=Bacillus cereus (strain ATCC 10987 / NRS 248) GN=cysA PE=3 SV=2 58 265 6.0E-19
sp|Q6F9A8|CYSA_ACIAD Sulfate/thiosulfate import ATP-binding protein CysA OS=Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1) GN=cysA PE=3 SV=1 61 265 6.0E-19
sp|P9WQK1|Y986_MYCTU Uncharacterized ABC transporter ATP-binding protein Rv0986 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=Rv0986 PE=1 SV=1 42 236 6.0E-19
sp|P9WQK0|Y986_MYCTO Uncharacterized ABC transporter ATP-binding protein MT1014 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=MT1014 PE=3 SV=1 42 236 6.0E-19
sp|Q83HT1|PSTB_TROW8 Phosphate import ATP-binding protein PstB OS=Tropheryma whipplei (strain TW08/27) GN=pstB PE=3 SV=1 58 239 8.0E-19
sp|Q9X196|POTA_THEMA Spermidine/putrescine import ATP-binding protein PotA OS=Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099) GN=potA PE=3 SV=1 50 265 2.0E-18
sp|Q65T42|CYSA_MANSM Sulfate/thiosulfate import ATP-binding protein CysA OS=Mannheimia succiniciproducens (strain MBEL55E) GN=cysA PE=3 SV=1 53 261 2.0E-18
sp|Q83GE8|PSTB_TROWT Phosphate import ATP-binding protein PstB OS=Tropheryma whipplei (strain Twist) GN=pstB PE=3 SV=2 58 239 3.0E-18
sp|Q7N6Z2|CYSA_PHOLL Sulfate/thiosulfate import ATP-binding protein CysA OS=Photorhabdus luminescens subsp. laumondii (strain TT01) GN=cysA PE=3 SV=1 46 266 3.0E-18
sp|Q8TQ05|Y1747_METAC Putative ABC transporter ATP-binding protein MA_1747 OS=Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A) GN=MA_1747 PE=3 SV=1 58 285 3.0E-18
sp|Q81GU1|CYSA_BACCR Sulfate/thiosulfate import ATP-binding protein CysA OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711) GN=cysA PE=3 SV=1 58 265 4.0E-18
sp|Q31DV4|PHNC_THICR Phosphonates import ATP-binding protein PhnC OS=Thiomicrospira crunogena (strain XCL-2) GN=phnC PE=3 SV=1 51 271 4.0E-18
sp|Q9STT5|AB7A_ARATH ABC transporter A family member 7 OS=Arabidopsis thaliana GN=ABCA7 PE=3 SV=2 1 240 6.0E-18
sp|Q9V2E4|Y130_PYRAB Putative ABC transporter ATP-binding protein PYRAB01300 OS=Pyrococcus abyssi (strain GE5 / Orsay) GN=PYRAB01300 PE=3 SV=1 61 262 6.0E-18
sp|Q1RK34|LOLD_RICBR Lipoprotein-releasing system ATP-binding protein LolD OS=Rickettsia bellii (strain RML369-C) GN=lolD PE=3 SV=1 42 246 7.0E-18
sp|Q8ZX91|PSTB_PYRAE Phosphate import ATP-binding protein PstB OS=Pyrobaculum aerophilum (strain ATCC 51768 / IM2 / DSM 7523 / JCM 9630 / NBRC 100827) GN=pstB PE=3 SV=1 63 238 7.0E-18
sp|Q9MUN1|CYSA_MESVI Sulfate/thiosulfate import ATP-binding protein CysA OS=Mesostigma viride GN=cysA PE=3 SV=1 58 262 8.0E-18
sp|O57872|Y132_PYRHO Putative ABC transporter ATP-binding protein PH0132 OS=Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3) GN=PH0132 PE=3 SV=1 64 276 9.0E-18
sp|O74676|CDR4_CANAX ABC transporter CDR4 OS=Candida albicans GN=CDR4 PE=3 SV=1 49 532 1.0E-17
sp|Q8UH62|CYSA1_AGRFC Sulfate/thiosulfate import ATP-binding protein CysA 1 OS=Agrobacterium fabrum (strain C58 / ATCC 33970) GN=cysA1 PE=3 SV=2 58 262 1.0E-17
sp|P10346|GLNQ_ECOLI Glutamine transport ATP-binding protein GlnQ OS=Escherichia coli (strain K12) GN=glnQ PE=1 SV=1 49 231 1.0E-17
sp|Q9FLT8|AB12A_ARATH ABC transporter A family member 12 OS=Arabidopsis thaliana GN=ABCA12 PE=3 SV=1 3 240 1.0E-17
sp|P33302|PDR5_YEAST Pleiotropic ABC efflux transporter of multiple drugs OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PDR5 PE=1 SV=1 25 416 2.0E-17
sp|P40550|PDR11_YEAST ATP-dependent permease PDR11 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PDR11 PE=1 SV=3 113 507 2.0E-17
sp|Q8UA73|CYSA2_AGRFC Sulfate/thiosulfate import ATP-binding protein CysA 2 OS=Agrobacterium fabrum (strain C58 / ATCC 33970) GN=cysA2 PE=3 SV=1 58 262 2.0E-17
sp|P94374|YXLF_BACSU Uncharacterized ABC transporter ATP-binding protein YxlF OS=Bacillus subtilis (strain 168) GN=yxlF PE=2 SV=1 43 233 2.0E-17
sp|Q7NIW1|CYSA_GLOVI Sulfate/thiosulfate import ATP-binding protein CysA OS=Gloeobacter violaceus (strain PCC 7421) GN=cysA PE=3 SV=1 58 270 2.0E-17
sp|Q9STT8|AB4A_ARATH ABC transporter A family member 4 OS=Arabidopsis thaliana GN=ABCA4 PE=3 SV=2 13 262 2.0E-17
sp|Q8U4L3|Y068_PYRFU Putative ABC transporter ATP-binding protein PF0068 OS=Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1) GN=PF0068 PE=3 SV=1 63 268 2.0E-17
sp|Q8D0W8|CYSA_YERPE Sulfate/thiosulfate import ATP-binding protein CysA OS=Yersinia pestis GN=cysA PE=3 SV=2 46 262 2.0E-17
sp|Q9JUX4|CYSA_NEIMA Sulfate/thiosulfate import ATP-binding protein CysA OS=Neisseria meningitidis serogroup A / serotype 4A (strain Z2491) GN=cysA PE=3 SV=1 49 239 2.0E-17
sp|Q8F6Z1|CYSA_LEPIN Sulfate/thiosulfate import ATP-binding protein CysA OS=Leptospira interrogans serogroup Icterohaemorrhagiae serovar Lai (strain 56601) GN=cysA PE=3 SV=2 51 280 3.0E-17
sp|Q72PE5|CYSA_LEPIC Sulfate/thiosulfate import ATP-binding protein CysA OS=Leptospira interrogans serogroup Icterohaemorrhagiae serovar copenhageni (strain Fiocruz L1-130) GN=cysA PE=3 SV=1 51 280 3.0E-17
sp|P9WQM1|CYSA_MYCTU Sulfate/thiosulfate import ATP-binding protein CysA OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=cysA PE=1 SV=2 51 262 3.0E-17
sp|P9WQM0|CYSA_MYCTO Sulfate/thiosulfate import ATP-binding protein CysA OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=cysA PE=3 SV=2 51 262 3.0E-17
sp|P0A4W3|CYSA_MYCBO Sulfate/thiosulfate import ATP-binding protein CysA OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=cysA PE=3 SV=2 51 262 3.0E-17
sp|Q9JZW0|CYSA_NEIMB Sulfate/thiosulfate import ATP-binding protein CysA OS=Neisseria meningitidis serogroup B (strain MC58) GN=cysA PE=3 SV=1 49 239 3.0E-17
sp|Q7UC29|CYSA_SHIFL Sulfate/thiosulfate import ATP-binding protein CysA OS=Shigella flexneri GN=cysA PE=3 SV=1 42 273 3.0E-17
sp|Q9K876|CYSA_BACHD Sulfate/thiosulfate import ATP-binding protein CysA OS=Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125) GN=cysA PE=3 SV=1 58 265 3.0E-17
sp|Q4QMH4|METN_HAEI8 Methionine import ATP-binding protein MetN OS=Haemophilus influenzae (strain 86-028NP) GN=metN PE=3 SV=1 51 234 4.0E-17
sp|Q3A558|LOLD_PELCD Lipoprotein-releasing system ATP-binding protein LolD OS=Pelobacter carbinolicus (strain DSM 2380 / Gra Bd 1) GN=lolD PE=3 SV=1 44 253 4.0E-17
sp|Q668K6|CYSA_YERPS Sulfate/thiosulfate import ATP-binding protein CysA OS=Yersinia pseudotuberculosis serotype I (strain IP32953) GN=cysA PE=3 SV=1 46 262 4.0E-17
sp|P16676|CYSA_ECOLI Sulfate/thiosulfate import ATP-binding protein CysA OS=Escherichia coli (strain K12) GN=cysA PE=3 SV=2 42 252 5.0E-17
sp|Q8XBJ8|CYSA_ECO57 Sulfate/thiosulfate import ATP-binding protein CysA OS=Escherichia coli O157:H7 GN=cysA PE=3 SV=1 42 252 5.0E-17
sp|Q7N8B9|FBPC_PHOLL Fe(3+) ions import ATP-binding protein FbpC OS=Photorhabdus luminescens subsp. laumondii (strain TT01) GN=fbpC PE=3 SV=1 50 290 5.0E-17
sp|Q8FFB3|CYSA_ECOL6 Sulfate/thiosulfate import ATP-binding protein CysA OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=cysA PE=3 SV=1 42 252 5.0E-17
sp|Q58488|ECFA_METJA Energy-coupling factor transporter ATP-binding protein EcfA OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=ecfA PE=3 SV=1 58 262 5.0E-17
sp|Q8Z4V6|CYSA_SALTI Sulfate/thiosulfate import ATP-binding protein CysA OS=Salmonella typhi GN=cysA PE=3 SV=1 42 252 5.0E-17
sp|Q92GP5|LOLD_RICCN Lipoprotein-releasing system ATP-binding protein LolD OS=Rickettsia conorii (strain ATCC VR-613 / Malish 7) GN=lolD PE=3 SV=1 43 246 6.0E-17
sp|Q67JX4|ECFA2_SYMTH Energy-coupling factor transporter ATP-binding protein EcfA2 OS=Symbiobacterium thermophilum (strain T / IAM 14863) GN=ecfA2 PE=3 SV=1 49 276 6.0E-17
sp|Q2JLH7|PHNC2_SYNJB Phosphonates import ATP-binding protein PhnC 2 OS=Synechococcus sp. (strain JA-2-3B'a(2-13)) GN=phnC2 PE=3 SV=1 58 261 7.0E-17
sp|P14788|CYSA_SYNE7 Sulfate/thiosulfate import ATP-binding protein CysA OS=Synechococcus elongatus (strain PCC 7942) GN=cysA PE=2 SV=1 51 262 7.0E-17
sp|Q5ZWE4|POTA_LEGPH Spermidine/putrescine import ATP-binding protein PotA OS=Legionella pneumophila subsp. pneumophila (strain Philadelphia 1 / ATCC 33152 / DSM 7513) GN=potA PE=3 SV=2 50 265 7.0E-17
sp|Q03PF2|POTA_LACBA Spermidine/putrescine import ATP-binding protein PotA OS=Lactobacillus brevis (strain ATCC 367 / JCM 1170) GN=potA PE=3 SV=1 43 262 7.0E-17
sp|Q54CG0|ABCGA_DICDI ABC transporter G family member 10 OS=Dictyostelium discoideum GN=abcG10 PE=3 SV=1 42 315 8.0E-17
sp|P40860|CYSA_SALTY Sulfate/thiosulfate import ATP-binding protein CysA OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=cysA PE=3 SV=2 42 252 8.0E-17
sp|Q7ULB5|MACB_RHOBA Macrolide export ATP-binding/permease protein MacB OS=Rhodopirellula baltica (strain DSM 10527 / NCIMB 13988 / SH1) GN=macB PE=3 SV=1 58 252 8.0E-17
sp|Q58206|Y796_METJA Uncharacterized ABC transporter ATP-binding protein MJ0796 OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=MJ0796 PE=1 SV=1 53 240 8.0E-17
sp|Q6D734|FBPC1_PECAS Fe(3+) ions import ATP-binding protein FbpC 1 OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) GN=fbpC1 PE=3 SV=1 50 290 8.0E-17
sp|Q10V16|PHNC2_TRIEI Phosphonates import ATP-binding protein PhnC 2 OS=Trichodesmium erythraeum (strain IMS101) GN=phnC2 PE=3 SV=1 59 260 8.0E-17
sp|Q5X627|POTA_LEGPA Spermidine/putrescine import ATP-binding protein PotA OS=Legionella pneumophila (strain Paris) GN=potA PE=3 SV=1 50 265 9.0E-17
sp|Q1PEH6|AB3A_ARATH ABC transporter A family member 3 OS=Arabidopsis thaliana GN=ABCA3 PE=2 SV=3 13 262 1.0E-16
sp|P56344|CYSA_CHLVU Probable sulfate/thiosulfate import ATP-binding protein CysA OS=Chlorella vulgaris GN=cysA PE=3 SV=1 51 239 1.0E-16
sp|Q9RYZ3|PSTB_DEIRA Phosphate import ATP-binding protein PstB OS=Deinococcus radiodurans (strain ATCC 13939 / DSM 20539 / JCM 16871 / LMG 4051 / NBRC 15346 / NCIMB 9279 / R1 / VKM B-1422) GN=pstB PE=3 SV=1 48 234 1.0E-16
sp|P10091|CYSA_MARPO Sulfate/thiosulfate import ATP-binding protein CysA OS=Marchantia polymorpha GN=cysA PE=3 SV=1 50 265 1.0E-16
sp|Q5YZY9|CYSA_NOCFA Sulfate/thiosulfate import ATP-binding protein CysA OS=Nocardia farcinica (strain IFM 10152) GN=cysA PE=3 SV=1 46 262 1.0E-16
sp|Q9PHQ1|PSTB_CAMJE Phosphate import ATP-binding protein PstB OS=Campylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168) GN=pstB PE=3 SV=1 46 272 1.0E-16
sp|P44785|METN_HAEIN Methionine import ATP-binding protein MetN OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=metN PE=3 SV=1 51 234 1.0E-16
sp|Q2IF17|LOLD_ANADE Lipoprotein-releasing system ATP-binding protein LolD OS=Anaeromyxobacter dehalogenans (strain 2CP-C) GN=lolD PE=3 SV=1 50 259 1.0E-16
sp|Q5HVF4|PSTB_CAMJR Phosphate import ATP-binding protein PstB OS=Campylobacter jejuni (strain RM1221) GN=pstB PE=3 SV=1 46 272 2.0E-16
sp|Q609Z8|PSTB_METCA Phosphate import ATP-binding protein PstB OS=Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath) GN=pstB PE=3 SV=1 48 259 2.0E-16
sp|Q7AH43|FBPC_ECO57 Fe(3+) ions import ATP-binding protein FbpC OS=Escherichia coli O157:H7 GN=fbpC PE=3 SV=2 50 288 2.0E-16
sp|Q1GH74|PSTB_RUEST Phosphate import ATP-binding protein PstB OS=Ruegeria sp. (strain TM1040) GN=pstB PE=3 SV=1 53 242 2.0E-16
sp|P94420|YCLP_BACSU Uncharacterized ABC transporter ATP-binding protein YclP OS=Bacillus subtilis (strain 168) GN=yclP PE=3 SV=1 48 265 2.0E-16
sp|Q6LKD4|FBPC_PHOPR Fe(3+) ions import ATP-binding protein FbpC OS=Photobacterium profundum GN=fbpC PE=3 SV=2 50 262 2.0E-16
sp|Q58418|PSTB_METJA Phosphate import ATP-binding protein PstB OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=pstB PE=3 SV=1 62 259 2.0E-16
sp|P74548|CYSA_SYNY3 Sulfate/thiosulfate import ATP-binding protein CysA OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=cysA PE=3 SV=1 58 266 2.0E-16
sp|Q9STT7|AB5A_ARATH ABC transporter A family member 5 OS=Arabidopsis thaliana GN=ABCA5 PE=3 SV=2 13 262 2.0E-16
sp|Q8DIA0|CYSA_THEEB Sulfate/thiosulfate import ATP-binding protein CysA OS=Thermosynechococcus elongatus (strain BP-1) GN=cysA PE=3 SV=1 51 266 2.0E-16
sp|Q58283|Y873_METJA Uncharacterized ABC transporter ATP-binding protein MJ0873 OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=MJ0873 PE=3 SV=4 54 265 2.0E-16
sp|Q3A9G5|METN_CARHZ Methionine import ATP-binding protein MetN OS=Carboxydothermus hydrogenoformans (strain ATCC BAA-161 / DSM 6008 / Z-2901) GN=metN PE=3 SV=1 44 234 2.0E-16
sp|Q74K65|POTA_LACJO Spermidine/putrescine import ATP-binding protein PotA OS=Lactobacillus johnsonii (strain CNCM I-12250 / La1 / NCC 533) GN=potA PE=3 SV=1 58 262 2.0E-16
sp|Q1WSB9|ECFA2_LACS1 Energy-coupling factor transporter ATP-binding protein EcfA2 OS=Lactobacillus salivarius (strain UCC118) GN=ecfA2 PE=3 SV=1 58 234 2.0E-16
sp|Q9FLT4|AB10A_ARATH ABC transporter A family member 10 OS=Arabidopsis thaliana GN=ABCA10 PE=1 SV=2 8 240 2.0E-16
sp|Q5L222|POTA_GEOKA Spermidine/putrescine import ATP-binding protein PotA OS=Geobacillus kaustophilus (strain HTA426) GN=potA PE=3 SV=1 50 262 3.0E-16
sp|P63354|CYSA_BRUSU Sulfate/thiosulfate import ATP-binding protein CysA OS=Brucella suis biovar 1 (strain 1330) GN=cysA PE=3 SV=1 42 262 3.0E-16
sp|P63353|CYSA_BRUME Sulfate/thiosulfate import ATP-binding protein CysA OS=Brucella melitensis biotype 1 (strain 16M / ATCC 23456 / NCTC 10094) GN=cysA PE=3 SV=1 42 262 3.0E-16
sp|Q8XHV3|ECFA2_CLOPE Energy-coupling factor transporter ATP-binding protein EcfA2 OS=Clostridium perfringens (strain 13 / Type A) GN=ecfA2 PE=3 SV=1 47 233 3.0E-16
sp|Q0TMS8|ECFA2_CLOP1 Energy-coupling factor transporter ATP-binding protein EcfA2 OS=Clostridium perfringens (strain ATCC 13124 / DSM 756 / JCM 1290 / NCIMB 6125 / NCTC 8237 / Type A) GN=ecfA2 PE=3 SV=1 47 233 3.0E-16
sp|Q166A0|PSTB_ROSDO Phosphate import ATP-binding protein PstB OS=Roseobacter denitrificans (strain ATCC 33942 / OCh 114) GN=pstB PE=3 SV=1 53 267 4.0E-16
sp|Q5WCI1|SSUB2_BACSK Aliphatic sulfonates import ATP-binding protein SsuB 2 OS=Bacillus clausii (strain KSM-K16) GN=ssuB2 PE=3 SV=1 46 253 4.0E-16
sp|Q5WDP1|METN3_BACSK Methionine import ATP-binding protein MetN 3 OS=Bacillus clausii (strain KSM-K16) GN=metN3 PE=3 SV=1 30 271 4.0E-16
sp|Q4UMZ7|LOLD_RICFE Lipoprotein-releasing system ATP-binding protein LolD OS=Rickettsia felis (strain ATCC VR-1525 / URRWXCal2) GN=lolD PE=3 SV=1 43 246 4.0E-16
sp|Q2FNX9|ECFA1_METHJ Energy-coupling factor transporter ATP-binding protein EcfA1 OS=Methanospirillum hungatei JF-1 (strain ATCC 27890 / DSM 864 / NBRC 100397 / JF-1) GN=ecfA1 PE=3 SV=1 49 236 5.0E-16
sp|Q7VMF9|MACB_HAEDU Macrolide export ATP-binding/permease protein MacB OS=Haemophilus ducreyi (strain 35000HP / ATCC 700724) GN=macB PE=3 SV=1 44 253 5.0E-16
sp|A1U0A9|MACB_MARHV Macrolide export ATP-binding/permease protein MacB OS=Marinobacter hydrocarbonoclasticus (strain ATCC 700491 / DSM 11845 / VT8) GN=macB PE=3 SV=1 50 238 5.0E-16
sp|Q9CM47|MACB_PASMU Macrolide export ATP-binding/permease protein MacB OS=Pasteurella multocida (strain Pm70) GN=macB PE=3 SV=1 44 231 5.0E-16
sp|A3CVD3|ECFA_METMJ Energy-coupling factor transporter ATP-binding protein EcfA OS=Methanoculleus marisnigri (strain ATCC 35101 / DSM 1498 / JR1) GN=ecfA PE=3 SV=1 64 234 5.0E-16
sp|Q02SA6|TAUB_PSEAB Taurine import ATP-binding protein TauB OS=Pseudomonas aeruginosa (strain UCBPP-PA14) GN=tauB PE=3 SV=1 45 267 5.0E-16
sp|Q6D3Q6|METN2_PECAS Methionine import ATP-binding protein MetN 2 OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) GN=metN2 PE=3 SV=1 51 236 6.0E-16
sp|Q5WXF0|POTA_LEGPL Spermidine/putrescine import ATP-binding protein PotA OS=Legionella pneumophila (strain Lens) GN=potA PE=3 SV=1 50 265 6.0E-16
sp|Q04F14|METN1_OENOB Methionine import ATP-binding protein MetN 1 OS=Oenococcus oeni (strain ATCC BAA-331 / PSU-1) GN=metN1 PE=3 SV=1 23 234 6.0E-16
sp|A0PXX8|ECFA2_CLONN Energy-coupling factor transporter ATP-binding protein EcfA2 OS=Clostridium novyi (strain NT) GN=ecfA2 PE=3 SV=1 47 255 6.0E-16
sp|Q2RFS8|ECFA_MOOTA Energy-coupling factor transporter ATP-binding protein EcfA OS=Moorella thermoacetica (strain ATCC 39073) GN=ecfA PE=3 SV=1 51 262 6.0E-16
sp|Q8PNN4|CYSA_XANAC Sulfate/thiosulfate import ATP-binding protein CysA OS=Xanthomonas axonopodis pv. citri (strain 306) GN=cysA PE=3 SV=2 51 261 7.0E-16
sp|Q8PC11|CYSA_XANCP Sulfate/thiosulfate import ATP-binding protein CysA OS=Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25) GN=cysA PE=3 SV=1 51 282 7.0E-16
sp|Q7M8M4|PHNC_WOLSU Phosphonates import ATP-binding protein PhnC OS=Wolinella succinogenes (strain ATCC 29543 / DSM 1740 / LMG 7466 / NCTC 11488 / FDC 602W) GN=phnC PE=3 SV=1 58 262 7.0E-16
sp|Q8XXB6|MSBA_RALSO Lipid A export ATP-binding/permease protein MsbA OS=Ralstonia solanacearum (strain GMI1000) GN=msbA PE=3 SV=1 42 230 7.0E-16
sp|Q0AU85|METN_SYNWW Methionine import ATP-binding protein MetN OS=Syntrophomonas wolfei subsp. wolfei (strain DSM 2245B / Goettingen) GN=metN PE=3 SV=1 58 233 8.0E-16
sp|O34697|BCEA_BACSU Bacitracin export ATP-binding protein BceA OS=Bacillus subtilis (strain 168) GN=bceA PE=2 SV=1 46 240 8.0E-16
sp|O68106|CBIO_RHOCB Cobalt import ATP-binding protein CbiO OS=Rhodobacter capsulatus (strain ATCC BAA-309 / NBRC 16581 / SB1003) GN=cbiO PE=1 SV=1 49 234 8.0E-16
sp|Q9HX79|TAUB_PSEAE Taurine import ATP-binding protein TauB OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=tauB PE=3 SV=1 45 267 9.0E-16
sp|Q8Z0H0|CYSA_NOSS1 Sulfate/thiosulfate import ATP-binding protein CysA OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=cysA PE=3 SV=1 51 262 9.0E-16
sp|Q2RWU0|PSTB_RHORT Phosphate import ATP-binding protein PstB OS=Rhodospirillum rubrum (strain ATCC 11170 / ATH 1.1.1 / DSM 467 / LMG 4362 / NCIB 8255 / S1) GN=pstB PE=3 SV=1 48 259 9.0E-16
sp|O74208|PDH1_CANGA ATP-binding cassette transporter CGR1 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=PDH1 PE=3 SV=3 2 385 1.0E-15
sp|Q1J0N0|PSTB_DEIGD Phosphate import ATP-binding protein PstB OS=Deinococcus geothermalis (strain DSM 11300) GN=pstB PE=3 SV=1 48 234 1.0E-15
sp|Q5LS19|PSTB_RUEPO Phosphate import ATP-binding protein PstB OS=Ruegeria pomeroyi (strain ATCC 700808 / DSM 15171 / DSS-3) GN=pstB PE=3 SV=2 49 242 1.0E-15
sp|Q830W6|POTA_ENTFA Spermidine/putrescine import ATP-binding protein PotA OS=Enterococcus faecalis (strain ATCC 700802 / V583) GN=potA PE=3 SV=1 50 262 1.0E-15
sp|Q39AT4|METN2_BURL3 Methionine import ATP-binding protein MetN 2 OS=Burkholderia lata (strain ATCC 17760 / LMG 22485 / NCIMB 9086 / R18194 / 383) GN=metN2 PE=3 SV=1 40 259 1.0E-15
sp|Q8T6J0|ABCA7_DICDI ABC transporter A family member 7 OS=Dictyostelium discoideum GN=abcA7 PE=3 SV=1 35 253 1.0E-15
sp|Q9CK97|METN_PASMU Methionine import ATP-binding protein MetN OS=Pasteurella multocida (strain Pm70) GN=metN PE=3 SV=1 51 234 1.0E-15
sp|A0B344|METN2_BURCH Methionine import ATP-binding protein MetN 2 OS=Burkholderia cenocepacia (strain HI2424) GN=metN2 PE=3 SV=1 40 259 1.0E-15
sp|Q1BR30|METN2_BURCA Methionine import ATP-binding protein MetN 2 OS=Burkholderia cenocepacia (strain AU 1054) GN=metN2 PE=3 SV=1 40 259 1.0E-15
sp|Q5PCG9|METN2_SALPA Methionine import ATP-binding protein MetN 2 OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=metN2 PE=3 SV=1 41 270 1.0E-15
sp|Q55BC0|ABCA8_DICDI ABC transporter A family member 8 OS=Dictyostelium discoideum GN=abcA8 PE=3 SV=1 58 228 1.0E-15
sp|Q7N8M2|METN_PHOLL Methionine import ATP-binding protein MetN OS=Photorhabdus luminescens subsp. laumondii (strain TT01) GN=metN PE=3 SV=1 42 234 1.0E-15
sp|Q6N999|LOLD1_RHOPA Lipoprotein-releasing system ATP-binding protein LolD 1 OS=Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009) GN=lolD1 PE=3 SV=1 50 253 2.0E-15
sp|Q9KL34|HMUV_VIBCH Hemin import ATP-binding protein HmuV OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=hmuV PE=3 SV=2 36 264 2.0E-15
sp|Q92VJ2|CYSA2_RHIME Sulfate/thiosulfate import ATP-binding protein CysA 2 OS=Rhizobium meliloti (strain 1021) GN=cysA2 PE=3 SV=1 42 266 2.0E-15
sp|Q668Q3|FBPC_YERPS Fe(3+) ions import ATP-binding protein FbpC OS=Yersinia pseudotuberculosis serotype I (strain IP32953) GN=fbpC PE=3 SV=1 50 262 2.0E-15
sp|Q1WVG9|METN_LACS1 Methionine import ATP-binding protein MetN OS=Lactobacillus salivarius (strain UCC118) GN=metN PE=3 SV=1 36 237 2.0E-15
sp|Q9ESR9|ABCA2_RAT ATP-binding cassette sub-family A member 2 OS=Rattus norvegicus GN=Abca2 PE=1 SV=1 10 231 2.0E-15
sp|Q1CJS9|FBPC_YERPN Fe(3+) ions import ATP-binding protein FbpC OS=Yersinia pestis bv. Antiqua (strain Nepal516) GN=fbpC PE=3 SV=1 50 262 2.0E-15
sp|Q8ZCM2|FBPC_YERPE Fe(3+) ions import ATP-binding protein FbpC OS=Yersinia pestis GN=fbpC PE=3 SV=1 50 262 2.0E-15
sp|Q1C607|FBPC_YERPA Fe(3+) ions import ATP-binding protein FbpC OS=Yersinia pestis bv. Antiqua (strain Antiqua) GN=fbpC PE=3 SV=1 50 262 2.0E-15
sp|Q65TH4|MACB_MANSM Macrolide export ATP-binding/permease protein MacB OS=Mannheimia succiniciproducens (strain MBEL55E) GN=macB PE=3 SV=1 43 238 2.0E-15
sp|O34392|YTRE_BACSU ABC transporter ATP-binding protein YtrE OS=Bacillus subtilis (strain 168) GN=ytrE PE=2 SV=1 36 238 2.0E-15
sp|O06980|YVCR_BACSU Uncharacterized ABC transporter ATP-binding protein YvcR OS=Bacillus subtilis (strain 168) GN=yvcR PE=3 SV=1 58 242 2.0E-15
sp|Q2W7J9|PSTB2_MAGSA Phosphate import ATP-binding protein PstB 2 OS=Magnetospirillum magneticum (strain AMB-1 / ATCC 700264) GN=pstB2 PE=3 SV=1 46 259 2.0E-15
sp|Q5XDS8|METN_STRP6 Methionine import ATP-binding protein MetN OS=Streptococcus pyogenes serotype M6 (strain ATCC BAA-946 / MGAS10394) GN=metN PE=3 SV=1 46 234 2.0E-15
sp|Q1JNE0|METN_STRPC Methionine import ATP-binding protein MetN OS=Streptococcus pyogenes serotype M12 (strain MGAS9429) GN=metN PE=3 SV=1 46 234 2.0E-15
sp|Q1JDG6|METN_STRPB Methionine import ATP-binding protein MetN OS=Streptococcus pyogenes serotype M12 (strain MGAS2096) GN=metN PE=3 SV=1 46 234 2.0E-15
sp|Q92WJ0|FBPC1_RHIME Fe(3+) ions import ATP-binding protein FbpC 1 OS=Rhizobium meliloti (strain 1021) GN=fbpC1 PE=3 SV=1 58 265 2.0E-15
sp|Q48V78|METN_STRPM Methionine import ATP-binding protein MetN OS=Streptococcus pyogenes serotype M28 (strain MGAS6180) GN=metN PE=3 SV=1 46 234 2.0E-15
sp|Q9A1E3|METN_STRP1 Methionine import ATP-binding protein MetN OS=Streptococcus pyogenes serotype M1 GN=metN PE=3 SV=1 46 234 2.0E-15
sp|P37009|FBPC_ECOLI Fe(3+) ions import ATP-binding protein FbpC OS=Escherichia coli (strain K12) GN=fbpC PE=3 SV=3 50 284 2.0E-15
sp|Q8P2K6|METN_STRP8 Methionine import ATP-binding protein MetN OS=Streptococcus pyogenes serotype M18 (strain MGAS8232) GN=metN PE=3 SV=1 46 234 2.0E-15
sp|Q3IM24|PHNC2_NATPD Phosphonates import ATP-binding protein PhnC 2 OS=Natronomonas pharaonis (strain ATCC 35678 / DSM 2160) GN=phnC2 PE=3 SV=1 51 258 2.0E-15
sp|P54954|YXEO_BACSU Probable amino-acid import ATP-binding protein YxeO OS=Bacillus subtilis (strain 168) GN=yxeO PE=1 SV=1 50 285 2.0E-15
sp|O42690|CDR3_CANAX Opaque-specific ABC transporter CDR3 OS=Candida albicans GN=CDR3 PE=2 SV=1 49 292 3.0E-15
sp|Q042G7|POTA_LACGA Spermidine/putrescine import ATP-binding protein PotA OS=Lactobacillus gasseri (strain ATCC 33323 / DSM 20243 / JCM 1131 / NCIMB 11718 / AM63) GN=potA PE=3 SV=2 58 262 3.0E-15
sp|Q146E7|TAUB1_BURXL Taurine import ATP-binding protein TauB 1 OS=Burkholderia xenovorans (strain LB400) GN=tauB1 PE=3 SV=1 33 240 3.0E-15
sp|Q85A69|CYSA_ANTFO Sulfate/thiosulfate import ATP-binding protein CysA OS=Anthoceros formosae GN=cysA PE=2 SV=1 49 239 3.0E-15
sp|O34979|YVRO_BACSU Uncharacterized ABC transporter ATP-binding protein YvrO OS=Bacillus subtilis (strain 168) GN=yvrO PE=3 SV=2 44 253 3.0E-15
sp|Q552P3|ABCAB_DICDI ABC transporter A family member 11 OS=Dictyostelium discoideum GN=abcA11 PE=3 SV=1 42 228 3.0E-15
sp|Q2KCV5|PSTB_RHIEC Phosphate import ATP-binding protein PstB OS=Rhizobium etli (strain CFN 42 / ATCC 51251) GN=pstB PE=3 SV=1 63 242 3.0E-15
sp|Q5PID0|METN1_SALPA Methionine import ATP-binding protein MetN 1 OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=metN1 PE=3 SV=1 42 234 3.0E-15
sp|Q1MLW4|PSTB1_RHIL3 Phosphate import ATP-binding protein PstB 1 OS=Rhizobium leguminosarum bv. viciae (strain 3841) GN=pstB1 PE=3 SV=1 58 242 3.0E-15
sp|Q2JB14|PHNC_FRASC Phosphonates import ATP-binding protein PhnC OS=Frankia sp. (strain CcI3) GN=phnC PE=3 SV=1 51 234 3.0E-15
sp|Q1WVI7|POTA_LACS1 Spermidine/putrescine import ATP-binding protein PotA OS=Lactobacillus salivarius (strain UCC118) GN=potA PE=3 SV=1 50 262 3.0E-15
sp|Q0C0L5|PSTB_HYPNA Phosphate import ATP-binding protein PstB OS=Hyphomonas neptunium (strain ATCC 15444) GN=pstB PE=3 SV=1 65 267 3.0E-15
sp|Q8U242|PSTB_PYRFU Phosphate import ATP-binding protein PstB OS=Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1) GN=pstB PE=3 SV=1 63 272 3.0E-15
sp|Q57S53|METN2_SALCH Methionine import ATP-binding protein MetN 2 OS=Salmonella choleraesuis (strain SC-B67) GN=metN2 PE=3 SV=1 41 270 4.0E-15
sp|Q83MC5|METN_SHIFL Methionine import ATP-binding protein MetN OS=Shigella flexneri GN=metN PE=3 SV=1 43 234 4.0E-15
sp|Q0T810|METN_SHIF8 Methionine import ATP-binding protein MetN OS=Shigella flexneri serotype 5b (strain 8401) GN=metN PE=3 SV=1 43 234 4.0E-15
sp|Q8NSN2|METN_CORGL Methionine import ATP-binding protein MetN OS=Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / LMG 3730 / NCIMB 10025) GN=metN PE=3 SV=1 30 338 4.0E-15
sp|Q0B6I6|METN2_BURCM Methionine import ATP-binding protein MetN 2 OS=Burkholderia ambifaria (strain ATCC BAA-244 / AMMD) GN=metN2 PE=3 SV=1 58 234 4.0E-15
sp|A0PY57|POTA_CLONN Spermidine/putrescine import ATP-binding protein PotA OS=Clostridium novyi (strain NT) GN=potA PE=3 SV=1 58 262 4.0E-15
sp|Q32JQ8|METN_SHIDS Methionine import ATP-binding protein MetN OS=Shigella dysenteriae serotype 1 (strain Sd197) GN=metN PE=3 SV=1 43 234 4.0E-15
sp|Q65S66|FBPC_MANSM Fe(3+) ions import ATP-binding protein FbpC OS=Mannheimia succiniciproducens (strain MBEL55E) GN=fbpC PE=3 SV=2 50 269 4.0E-15
sp|Q9KFL0|PHNC2_BACHD Phosphonates import ATP-binding protein PhnC 2 OS=Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125) GN=phnC2 PE=3 SV=2 58 266 4.0E-15
sp|Q9BZC7|ABCA2_HUMAN ATP-binding cassette sub-family A member 2 OS=Homo sapiens GN=ABCA2 PE=1 SV=3 10 231 4.0E-15
sp|Q0SVB6|PSTB_CLOPS Phosphate import ATP-binding protein PstB OS=Clostridium perfringens (strain SM101 / Type A) GN=pstB PE=3 SV=1 58 267 4.0E-15
sp|Q8XMP8|PSTB_CLOPE Phosphate import ATP-binding protein PstB OS=Clostridium perfringens (strain 13 / Type A) GN=pstB PE=3 SV=1 58 267 4.0E-15
sp|Q0TTG6|PSTB_CLOP1 Phosphate import ATP-binding protein PstB OS=Clostridium perfringens (strain ATCC 13124 / DSM 756 / JCM 1290 / NCIMB 6125 / NCTC 8237 / Type A) GN=pstB PE=3 SV=1 58 267 4.0E-15
sp|Q4L8L7|HRTA_STAHJ Putative hemin import ATP-binding protein HrtA OS=Staphylococcus haemolyticus (strain JCSC1435) GN=hrtA PE=3 SV=1 44 253 4.0E-15
sp|Q578K3|FBPC_BRUAB Fe(3+) ions import ATP-binding protein FbpC OS=Brucella abortus biovar 1 (strain 9-941) GN=fbpC PE=3 SV=1 53 265 4.0E-15
sp|Q2YKX3|FBPC_BRUA2 Fe(3+) ions import ATP-binding protein FbpC OS=Brucella abortus (strain 2308) GN=fbpC PE=3 SV=1 53 265 4.0E-15
sp|Q68W38|LOLD_RICTY Lipoprotein-releasing system ATP-binding protein LolD OS=Rickettsia typhi (strain ATCC VR-144 / Wilmington) GN=lolD PE=3 SV=1 42 246 4.0E-15
sp|P30750|METN_ECOLI Methionine import ATP-binding protein MetN OS=Escherichia coli (strain K12) GN=metN PE=1 SV=4 43 234 4.0E-15
sp|Q323M3|MACB_SHIBS Macrolide export ATP-binding/permease protein MacB OS=Shigella boydii serotype 4 (strain Sb227) GN=macB PE=3 SV=1 51 238 4.0E-15
sp|Q9X0Y8|PSTB_THEMA Phosphate import ATP-binding protein PstB OS=Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099) GN=pstB PE=3 SV=1 48 265 4.0E-15
sp|Q65VG9|METN_MANSM Methionine import ATP-binding protein MetN OS=Mannheimia succiniciproducens (strain MBEL55E) GN=metN PE=3 SV=1 49 234 5.0E-15
sp|Q73P71|PHNC_TREDE Phosphonates import ATP-binding protein PhnC OS=Treponema denticola (strain ATCC 35405 / CIP 103919 / DSM 14222) GN=phnC PE=3 SV=1 58 260 5.0E-15
sp|Q38VW6|POTA_LACSS Spermidine/putrescine import ATP-binding protein PotA OS=Lactobacillus sakei subsp. sakei (strain 23K) GN=potA PE=3 SV=1 43 294 5.0E-15
sp|P41234|ABCA2_MOUSE ATP-binding cassette sub-family A member 2 OS=Mus musculus GN=Abca2 PE=1 SV=4 10 231 5.0E-15
sp|Q47Y12|PSTB_COLP3 Phosphate import ATP-binding protein PstB OS=Colwellia psychrerythraea (strain 34H / ATCC BAA-681) GN=pstB PE=3 SV=1 47 267 5.0E-15
sp|Q1R0Z6|PHNC_CHRSD Phosphonates import ATP-binding protein PhnC OS=Chromohalobacter salexigens (strain DSM 3043 / ATCC BAA-138 / NCIMB 13768) GN=phnC PE=3 SV=1 58 260 5.0E-15
sp|Q6MCV4|POTA_PARUW Spermidine/putrescine import ATP-binding protein PotA OS=Protochlamydia amoebophila (strain UWE25) GN=potA PE=3 SV=1 51 287 6.0E-15
sp|Q64SQ6|POTA_BACFR Spermidine/putrescine import ATP-binding protein PotA OS=Bacteroides fragilis (strain YCH46) GN=potA PE=3 SV=2 46 262 6.0E-15
sp|Q8Y8T6|POTA_LISMO Spermidine/putrescine import ATP-binding protein PotA OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=potA PE=3 SV=2 50 262 6.0E-15
sp|Q8TYV9|Y182_METKA Putative ABC transporter ATP-binding protein MK0182 OS=Methanopyrus kandleri (strain AV19 / DSM 6324 / JCM 9639 / NBRC 100938) GN=MK0182 PE=3 SV=1 58 262 6.0E-15
sp|Q3Z5F8|METN_SHISS Methionine import ATP-binding protein MetN OS=Shigella sonnei (strain Ss046) GN=metN PE=3 SV=1 43 234 6.0E-15
sp|Q1RFY9|METN_ECOUT Methionine import ATP-binding protein MetN OS=Escherichia coli (strain UTI89 / UPEC) GN=metN PE=3 SV=1 43 234 6.0E-15
sp|P63355|METN_ECOL6 Methionine import ATP-binding protein MetN OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=metN PE=3 SV=1 43 234 6.0E-15
sp|P63356|METN_ECO57 Methionine import ATP-binding protein MetN OS=Escherichia coli O157:H7 GN=metN PE=3 SV=1 43 234 6.0E-15
sp|Q0TLD2|METN_ECOL5 Methionine import ATP-binding protein MetN OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=metN PE=3 SV=1 43 234 6.0E-15
sp|Q8XED0|MACB_ECO57 Macrolide export ATP-binding/permease protein MacB OS=Escherichia coli O157:H7 GN=macB PE=3 SV=1 51 238 6.0E-15
sp|Q8X5I6|TAUB_ECO57 Taurine import ATP-binding protein TauB OS=Escherichia coli O157:H7 GN=tauB PE=3 SV=1 48 248 6.0E-15
sp|Q57293|FBPC_ACTPL Fe(3+) ions import ATP-binding protein FbpC OS=Actinobacillus pleuropneumoniae GN=fbpC PE=3 SV=1 43 252 6.0E-15
sp|A3DJK5|ECFA2_CLOTH Energy-coupling factor transporter ATP-binding protein EcfA2 OS=Clostridium thermocellum (strain ATCC 27405 / DSM 1237 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) GN=ecfA2 PE=3 SV=1 48 259 6.0E-15
sp|Q8ZR89|METN2_SALTY Methionine import ATP-binding protein MetN 2 OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=metN2 PE=3 SV=1 41 270 6.0E-15
sp|Q73XU8|CYSA_MYCPA Sulfate/thiosulfate import ATP-binding protein CysA OS=Mycobacterium paratuberculosis (strain ATCC BAA-968 / K-10) GN=cysA PE=3 SV=1 51 262 7.0E-15
sp|Q32DZ9|MACB_SHIDS Macrolide export ATP-binding/permease protein MacB OS=Shigella dysenteriae serotype 1 (strain Sd197) GN=macB PE=3 SV=1 51 264 7.0E-15
sp|Q82TL6|POTA_NITEU Spermidine/putrescine import ATP-binding protein PotA OS=Nitrosomonas europaea (strain ATCC 19718 / NBRC 14298) GN=potA PE=3 SV=1 51 261 7.0E-15
sp|Q5LBT4|POTA_BACFN Spermidine/putrescine import ATP-binding protein PotA OS=Bacteroides fragilis (strain ATCC 25285 / DSM 2151 / JCM 11019 / NCTC 9343) GN=potA PE=3 SV=1 46 262 7.0E-15
sp|Q92DL6|POTA_LISIN Spermidine/putrescine import ATP-binding protein PotA OS=Listeria innocua serovar 6a (strain CLIP 11262) GN=potA PE=3 SV=2 50 262 9.0E-15
sp|A0AGP9|POTA_LISW6 Spermidine/putrescine import ATP-binding protein PotA OS=Listeria welshimeri serovar 6b (strain ATCC 35897 / DSM 20650 / SLCC5334) GN=potA PE=3 SV=1 50 262 9.0E-15
sp|Q9STT6|AB6A_ARATH ABC transporter A family member 6 OS=Arabidopsis thaliana GN=ABCA6 PE=3 SV=2 10 262 9.0E-15
sp|Q0I5E9|METN_HAES1 Methionine import ATP-binding protein MetN OS=Haemophilus somnus (strain 129Pt) GN=metN PE=3 SV=1 46 234 9.0E-15
sp|Q9ZCM4|LOLD_RICPR Lipoprotein-releasing system ATP-binding protein LolD OS=Rickettsia prowazekii (strain Madrid E) GN=lolD PE=3 SV=1 42 246 9.0E-15
sp|P0C0E2|SRTF_STRPY Lantibiotic transport ATP-binding protein SrtF OS=Streptococcus pyogenes GN=srtF PE=3 SV=1 42 275 9.0E-15
sp|P0C0E3|SRTF_STRP1 Lantibiotic transport ATP-binding protein SrtF OS=Streptococcus pyogenes serotype M1 GN=srtF PE=3 SV=1 42 275 9.0E-15
sp|Q16BJ3|TAUB_ROSDO Taurine import ATP-binding protein TauB OS=Roseobacter denitrificans (strain ATCC 33942 / OCh 114) GN=tauB PE=3 SV=1 58 240 9.0E-15
sp|Q8A883|POTA_BACTN Spermidine/putrescine import ATP-binding protein PotA OS=Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / NCTC 10582 / E50 / VPI-5482) GN=potA PE=3 SV=1 48 262 9.0E-15
sp|Q8FVV5|FBPC_BRUSU Fe(3+) ions import ATP-binding protein FbpC OS=Brucella suis biovar 1 (strain 1330) GN=fbpC PE=3 SV=1 53 265 9.0E-15
sp|Q87J32|HMUV_VIBPA Hemin import ATP-binding protein HmuV OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) GN=hmuV PE=3 SV=2 50 259 9.0E-15
sp|Q8R9L8|Y1589_CALS4 Putative ABC transporter ATP-binding protein TTE1589 OS=Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4) GN=TTE1589 PE=3 SV=1 43 265 1.0E-14
sp|P0CZ31|METN_STRPQ Methionine import ATP-binding protein MetN OS=Streptococcus pyogenes serotype M3 (strain SSI-1) GN=metN PE=3 SV=1 46 234 1.0E-14
sp|P0CZ30|METN_STRP3 Methionine import ATP-binding protein MetN OS=Streptococcus pyogenes serotype M3 (strain ATCC BAA-595 / MGAS315) GN=metN PE=3 SV=1 46 234 1.0E-14
sp|A3DJK3|ECFA1_CLOTH Energy-coupling factor transporter ATP-binding protein EcfA1 OS=Clostridium thermocellum (strain ATCC 27405 / DSM 1237 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) GN=ecfA1 PE=3 SV=2 61 276 1.0E-14
sp|Q2IGQ6|PSTB_ANADE Phosphate import ATP-binding protein PstB OS=Anaeromyxobacter dehalogenans (strain 2CP-C) GN=pstB PE=3 SV=1 62 267 1.0E-14
sp|Q722B1|POTA_LISMF Spermidine/putrescine import ATP-binding protein PotA OS=Listeria monocytogenes serotype 4b (strain F2365) GN=potA PE=3 SV=2 50 262 1.0E-14
sp|Q9I6T2|POTA1_PSEAE Spermidine/putrescine import ATP-binding protein PotA 1 OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=potA1 PE=3 SV=1 62 265 1.0E-14
sp|Q325U1|METN_SHIBS Methionine import ATP-binding protein MetN OS=Shigella boydii serotype 4 (strain Sb227) GN=metN PE=3 SV=1 51 234 1.0E-14
sp|Q8Z8R5|METN2_SALTI Methionine import ATP-binding protein MetN 2 OS=Salmonella typhi GN=metN2 PE=3 SV=1 41 270 1.0E-14
sp|Q8UI76|PSTB_AGRFC Phosphate import ATP-binding protein PstB OS=Agrobacterium fabrum (strain C58 / ATCC 33970) GN=pstB PE=3 SV=1 58 262 1.0E-14
sp|Q24QI5|METN_DESHY Methionine import ATP-binding protein MetN OS=Desulfitobacterium hafniense (strain Y51) GN=metN PE=3 SV=1 46 278 1.0E-14
sp|Q9TKX3|CYSA_NEPOL Sulfate/thiosulfate import ATP-binding protein CysA OS=Nephroselmis olivacea GN=cysA PE=3 SV=1 51 266 1.0E-14
sp|Q3ILC5|PSTB_PSEHT Phosphate import ATP-binding protein PstB OS=Pseudoalteromonas haloplanktis (strain TAC 125) GN=pstB PE=3 SV=1 48 267 1.0E-14
sp|Q3Z3Q4|MACB_SHISS Macrolide export ATP-binding/permease protein MacB OS=Shigella sonnei (strain Ss046) GN=macB PE=3 SV=1 44 238 1.0E-14
sp|P0A9U2|YBHF_SHIFL Uncharacterized ABC transporter ATP-binding protein YbhF OS=Shigella flexneri GN=ybhF PE=3 SV=1 48 260 1.0E-14
sp|P0A9U1|YBHF_ECOLI Uncharacterized ABC transporter ATP-binding protein YbhF OS=Escherichia coli (strain K12) GN=ybhF PE=1 SV=1 48 260 1.0E-14
sp|Q0ASQ1|PHNC_MARMM Phosphonates import ATP-binding protein PhnC OS=Maricaulis maris (strain MCS10) GN=phnC PE=3 SV=1 51 259 1.0E-14
sp|Q8G7F4|PSTB_BIFLO Phosphate import ATP-binding protein PstB OS=Bifidobacterium longum (strain NCC 2705) GN=pstB PE=3 SV=1 51 239 1.0E-14
sp|Q57554|Y089_METJA Uncharacterized ABC transporter ATP-binding protein MJ0089 OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=MJ0089 PE=3 SV=1 34 252 1.0E-14
sp|Q57T09|METN1_SALCH Methionine import ATP-binding protein MetN 1 OS=Salmonella choleraesuis (strain SC-B67) GN=metN1 PE=3 SV=2 42 234 1.0E-14
sp|Q3Z542|TAUB_SHISS Taurine import ATP-binding protein TauB OS=Shigella sonnei (strain Ss046) GN=tauB PE=3 SV=1 48 250 1.0E-14
sp|Q47538|TAUB_ECOLI Taurine import ATP-binding protein TauB OS=Escherichia coli (strain K12) GN=tauB PE=2 SV=1 48 250 1.0E-14
sp|Q8T664|ABCH2_DICDI ABC transporter H family member 2 OS=Dictyostelium discoideum GN=abcH2 PE=3 SV=1 31 253 1.0E-14
sp|P75831|MACB_ECOLI Macrolide export ATP-binding/permease protein MacB OS=Escherichia coli (strain K12) GN=macB PE=1 SV=1 44 238 1.0E-14
sp|P43245|MDR1_RAT Multidrug resistance protein 1 OS=Rattus norvegicus GN=Abcb1 PE=2 SV=1 21 300 1.0E-14
sp|Q6D1C4|METN3_PECAS Methionine import ATP-binding protein MetN 3 OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) GN=metN3 PE=3 SV=1 58 234 1.0E-14
sp|Q39CJ6|TAUB_BURL3 Taurine import ATP-binding protein TauB OS=Burkholderia lata (strain ATCC 17760 / LMG 22485 / NCIMB 9086 / R18194 / 383) GN=tauB PE=3 SV=1 33 240 1.0E-14
sp|Q1RE44|MACB_ECOUT Macrolide export ATP-binding/permease protein MacB OS=Escherichia coli (strain UTI89 / UPEC) GN=macB PE=3 SV=1 44 238 1.0E-14
sp|A1A9B7|MACB1_ECOK1 Macrolide export ATP-binding/permease protein MacB 1 OS=Escherichia coli O1:K1 / APEC GN=macB1 PE=3 SV=1 44 238 1.0E-14
sp|Q0TJH0|MACB_ECOL5 Macrolide export ATP-binding/permease protein MacB OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=macB PE=3 SV=1 44 238 1.0E-14
sp|Q0K1N8|PHNC2_CUPNH Phosphonates import ATP-binding protein PhnC 2 OS=Cupriavidus necator (strain ATCC 17699 / H16 / DSM 428 / Stanier 337) GN=phnC2 PE=3 SV=1 48 259 1.0E-14
sp|Q5WIL7|PHNC_BACSK Phosphonates import ATP-binding protein PhnC OS=Bacillus clausii (strain KSM-K16) GN=phnC PE=3 SV=1 53 278 1.0E-14
sp|Q04G50|POTA_OENOB Spermidine/putrescine import ATP-binding protein PotA OS=Oenococcus oeni (strain ATCC BAA-331 / PSU-1) GN=potA PE=3 SV=2 50 262 1.0E-14
sp|Q46Y89|MSBA_CUPPJ Lipid A export ATP-binding/permease protein MsbA OS=Cupriavidus pinatubonensis (strain JMP 134 / LMG 1197) GN=msbA PE=3 SV=1 42 258 1.0E-14
sp|P75612|Y081_MYCPN Putative ABC transporter ATP-binding protein MG065 homolog OS=Mycoplasma pneumoniae (strain ATCC 29342 / M129) GN=MPN_081 PE=3 SV=1 18 215 1.0E-14
sp|Q46TK4|PHNC_CUPPJ Phosphonates import ATP-binding protein PhnC OS=Cupriavidus pinatubonensis (strain JMP 134 / LMG 1197) GN=phnC PE=3 SV=1 48 259 1.0E-14
sp|Q8R9I2|PSTB2_CALS4 Phosphate import ATP-binding protein PstB 2 OS=Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4) GN=pstB2 PE=3 SV=1 58 239 1.0E-14
sp|Q035B2|ECFA1_LACC3 Energy-coupling factor transporter ATP-binding protein EcfA1 OS=Lactobacillus casei (strain ATCC 334) GN=ecfA1 PE=1 SV=1 58 271 1.0E-14
sp|Q0VT01|MACB_ALCBS Macrolide export ATP-binding/permease protein MacB OS=Alcanivorax borkumensis (strain ATCC 700651 / DSM 11573 / NCIMB 13689 / SK2) GN=macB PE=3 SV=1 44 231 1.0E-14
sp|Q667L9|METN2_YERPS Methionine import ATP-binding protein MetN 2 OS=Yersinia pseudotuberculosis serotype I (strain IP32953) GN=metN2 PE=3 SV=1 42 253 1.0E-14
sp|Q9KLQ5|FBPC_VIBCH Fe(3+) ions import ATP-binding protein FbpC OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=fbpC PE=3 SV=1 50 262 1.0E-14
sp|Q9UZU7|PSTB_PYRAB Phosphate import ATP-binding protein PstB OS=Pyrococcus abyssi (strain GE5 / Orsay) GN=pstB PE=3 SV=2 65 272 2.0E-14
sp|O32169|METN_BACSU Methionine import ATP-binding protein MetN OS=Bacillus subtilis (strain 168) GN=metN PE=1 SV=1 49 271 2.0E-14
sp|Q1JII9|METN_STRPD Methionine import ATP-binding protein MetN OS=Streptococcus pyogenes serotype M2 (strain MGAS10270) GN=metN PE=3 SV=1 46 234 2.0E-14
sp|Q5SLN1|PSTB_THET8 Phosphate import ATP-binding protein PstB OS=Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) GN=pstB PE=3 SV=1 62 239 2.0E-14
sp|Q88YN5|PHNC_LACPL Phosphonates import ATP-binding protein PhnC OS=Lactobacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1) GN=phnC PE=3 SV=1 45 298 2.0E-14
sp|Q3SGJ8|PHNC_THIDA Phosphonates import ATP-binding protein PhnC OS=Thiobacillus denitrificans (strain ATCC 25259) GN=phnC PE=3 SV=1 58 262 2.0E-14
sp|Q92XW1|CYSA1_RHIME Sulfate/thiosulfate import ATP-binding protein CysA 1 OS=Rhizobium meliloti (strain 1021) GN=cysA1 PE=3 SV=1 60 266 2.0E-14
sp|Q1J8E4|METN_STRPF Methionine import ATP-binding protein MetN OS=Streptococcus pyogenes serotype M4 (strain MGAS10750) GN=metN PE=3 SV=1 46 234 2.0E-14
sp|Q8FKF5|TAUB_ECOL6 Taurine import ATP-binding protein TauB OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=tauB PE=3 SV=1 48 248 2.0E-14
sp|Q2EHL8|MACB_AGGAC Macrolide export ATP-binding/permease protein MacB OS=Aggregatibacter actinomycetemcomitans GN=macB PE=1 SV=2 43 238 2.0E-14
sp|Q9K619|BCEA_BACHD Bacitracin export ATP-binding protein BceA OS=Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125) GN=bceA PE=3 SV=1 46 240 2.0E-14
sp|P42423|YXDL_BACSU ABC transporter ATP-binding protein YxdL OS=Bacillus subtilis (strain 168) GN=yxdL PE=2 SV=2 58 240 2.0E-14
sp|Q325N3|TAUB_SHIBS Taurine import ATP-binding protein TauB OS=Shigella boydii serotype 4 (strain Sb227) GN=tauB PE=3 SV=1 48 250 2.0E-14
sp|Q72GX5|PSTB_THET2 Phosphate import ATP-binding protein PstB OS=Thermus thermophilus (strain HB27 / ATCC BAA-163 / DSM 7039) GN=pstB PE=3 SV=1 62 239 2.0E-14
sp|Q832Y6|METN1_ENTFA Methionine import ATP-binding protein MetN 1 OS=Enterococcus faecalis (strain ATCC 700802 / V583) GN=metN1 PE=3 SV=1 30 234 2.0E-14
sp|Q88XV2|ECFA1_LACPL Energy-coupling factor transporter ATP-binding protein EcfA1 OS=Lactobacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1) GN=ecfA1 PE=3 SV=1 58 276 2.0E-14
sp|Q3Z3K7|MSBA_SHISS Lipid A export ATP-binding/permease protein MsbA OS=Shigella sonnei (strain Ss046) GN=msbA PE=3 SV=1 8 266 2.0E-14
sp|Q9KS33|POTA_VIBCH Spermidine/putrescine import ATP-binding protein PotA OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=potA PE=3 SV=1 13 265 2.0E-14
sp|Q4K681|POTA_PSEF5 Spermidine/putrescine import ATP-binding protein PotA OS=Pseudomonas fluorescens (strain Pf-5 / ATCC BAA-477) GN=potA PE=3 SV=1 51 265 2.0E-14
sp|Q6NJ07|METN_CORDI Methionine import ATP-binding protein MetN OS=Corynebacterium diphtheriae (strain ATCC 700971 / NCTC 13129 / Biotype gravis) GN=metN PE=3 SV=1 45 258 2.0E-14
sp|Q17VE0|METN_HELAH Methionine import ATP-binding protein MetN OS=Helicobacter acinonychis (strain Sheeba) GN=metN PE=3 SV=1 58 234 2.0E-14
sp|Q2IWV8|LOLD_RHOP2 Lipoprotein-releasing system ATP-binding protein LolD OS=Rhodopseudomonas palustris (strain HaA2) GN=lolD PE=3 SV=1 43 233 2.0E-14
sp|Q9EUS2|PSTB_STRGR Phosphate import ATP-binding protein PstB OS=Streptomyces griseus GN=pstB PE=3 SV=1 51 267 2.0E-14
sp|Q8Z990|METN1_SALTI Methionine import ATP-binding protein MetN 1 OS=Salmonella typhi GN=metN1 PE=3 SV=1 42 234 2.0E-14
sp|Q3SRG8|LOLD_NITWN Lipoprotein-releasing system ATP-binding protein LolD OS=Nitrobacter winogradskyi (strain Nb-255 / ATCC 25391) GN=lolD PE=3 SV=1 43 233 2.0E-14
sp|Q72Y96|METN3_BACC1 Methionine import ATP-binding protein MetN 3 OS=Bacillus cereus (strain ATCC 10987 / NRS 248) GN=metN3 PE=3 SV=1 51 262 3.0E-14
sp|Q4L5B3|POTA_STAHJ Spermidine/putrescine import ATP-binding protein PotA OS=Staphylococcus haemolyticus (strain JCSC1435) GN=potA PE=3 SV=1 30 262 3.0E-14
sp|Q1QLB0|LOLD_NITHX Lipoprotein-releasing system ATP-binding protein LolD OS=Nitrobacter hamburgensis (strain X14 / DSM 10229) GN=lolD PE=3 SV=1 43 233 3.0E-14
sp|Q04DA7|METN2_OENOB Methionine import ATP-binding protein MetN 2 OS=Oenococcus oeni (strain ATCC BAA-331 / PSU-1) GN=metN2 PE=3 SV=1 36 234 3.0E-14
sp|Q815Y7|METN3_BACCR Methionine import ATP-binding protein MetN 3 OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711) GN=metN3 PE=3 SV=1 51 262 3.0E-14
sp|Q2FRT7|ECFA2_METHJ Energy-coupling factor transporter ATP-binding protein EcfA2 OS=Methanospirillum hungatei JF-1 (strain ATCC 27890 / DSM 864 / NBRC 100397 / JF-1) GN=ecfA2 PE=3 SV=1 53 263 3.0E-14
sp|Q92SA1|PSTB_RHIME Phosphate import ATP-binding protein PstB OS=Rhizobium meliloti (strain 1021) GN=pstB PE=3 SV=1 63 242 3.0E-14
sp|Q0I3C2|LOLD_HAES1 Lipoprotein-releasing system ATP-binding protein LolD OS=Haemophilus somnus (strain 129Pt) GN=lolD PE=3 SV=1 42 233 3.0E-14
sp|Q9CM80|FBPC_PASMU Fe(3+) ions import ATP-binding protein FbpC OS=Pasteurella multocida (strain Pm70) GN=fbpC PE=3 SV=1 50 261 3.0E-14
sp|Q02ME3|METN1_PSEAB Methionine import ATP-binding protein MetN 1 OS=Pseudomonas aeruginosa (strain UCBPP-PA14) GN=metN1 PE=3 SV=1 58 264 3.0E-14
sp|Q890R3|ECFA2_CLOTE Energy-coupling factor transporter ATP-binding protein EcfA2 OS=Clostridium tetani (strain Massachusetts / E88) GN=ecfA2 PE=3 SV=1 47 261 3.0E-14
sp|Q72FW5|POTA_DESVH Spermidine/putrescine import ATP-binding protein PotA OS=Desulfovibrio vulgaris (strain Hildenborough / ATCC 29579 / NCIMB 8303) GN=potA PE=3 SV=1 30 265 3.0E-14
sp|Q928L8|METN2_LISIN Methionine import ATP-binding protein MetN 2 OS=Listeria innocua serovar 6a (strain CLIP 11262) GN=metN2 PE=3 SV=1 46 271 3.0E-14
sp|Q60AA3|MSBA_METCA Lipid A export ATP-binding/permease protein MsbA OS=Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath) GN=msbA PE=3 SV=1 29 229 3.0E-14
sp|Q1RFH8|TAUB_ECOUT Taurine import ATP-binding protein TauB OS=Escherichia coli (strain UTI89 / UPEC) GN=tauB PE=3 SV=1 48 248 3.0E-14
sp|Q0TKS1|TAUB_ECOL5 Taurine import ATP-binding protein TauB OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=tauB PE=3 SV=1 48 248 3.0E-14
sp|Q8ELR4|POTA_OCEIH Spermidine/putrescine import ATP-binding protein PotA OS=Oceanobacillus iheyensis (strain DSM 14371 / JCM 11309 / KCTC 3954 / HTE831) GN=potA PE=3 SV=1 50 262 3.0E-14
sp|Q45460|OPUBA_BACSU Choline transport ATP-binding protein OpuBA OS=Bacillus subtilis (strain 168) GN=opuBA PE=2 SV=2 48 314 3.0E-14
sp|Q8Y4L8|METN2_LISMO Methionine import ATP-binding protein MetN 2 OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=metN2 PE=3 SV=1 46 271 3.0E-14
sp|Q32IZ6|TAUB_SHIDS Taurine import ATP-binding protein TauB OS=Shigella dysenteriae serotype 1 (strain Sd197) GN=tauB PE=3 SV=1 48 250 3.0E-14
sp|Q18KE1|PHNC1_HALWD Phosphonates import ATP-binding protein PhnC 1 OS=Haloquadratum walsbyi (strain DSM 16790 / HBSQ001) GN=phnC1 PE=3 SV=1 51 258 3.0E-14
sp|Q2NHW1|PSTB_METST Phosphate import ATP-binding protein PstB OS=Methanosphaera stadtmanae (strain ATCC 43021 / DSM 3091 / JCM 11832 / MCB-3) GN=pstB PE=3 SV=1 49 239 3.0E-14
sp|P21410|FBPC_SERMA Fe(3+) ions import ATP-binding protein FbpC OS=Serratia marcescens GN=fbpC PE=3 SV=1 49 262 3.0E-14
sp|Q8ZPK4|OSMV_SALTY Osmoprotectant import ATP-binding protein OsmV OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=osmV PE=1 SV=1 42 239 4.0E-14
sp|Q8PVG9|Y1996_METMA Putative ABC transporter ATP-binding protein MM_1996 OS=Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88) GN=MM_1996 PE=3 SV=1 58 298 4.0E-14
sp|Q8CUY0|PHNC2_OCEIH Phosphonates import ATP-binding protein PhnC 2 OS=Oceanobacillus iheyensis (strain DSM 14371 / JCM 11309 / KCTC 3954 / HTE831) GN=phnC2 PE=3 SV=1 50 261 4.0E-14
sp|Q142P6|MSBA_BURXL Lipid A export ATP-binding/permease protein MsbA OS=Burkholderia xenovorans (strain LB400) GN=msbA PE=3 SV=1 30 258 4.0E-14
sp|Q2SJY7|POTA_HAHCH Spermidine/putrescine import ATP-binding protein PotA OS=Hahella chejuensis (strain KCTC 2396) GN=potA PE=3 SV=1 58 265 4.0E-14
sp|Q8Y4E9|PSTB2_LISMO Phosphate import ATP-binding protein PstB 2 OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=pstB2 PE=3 SV=1 62 239 4.0E-14
sp|Q3MAR5|POTA_ANAVT Spermidine/putrescine import ATP-binding protein PotA OS=Anabaena variabilis (strain ATCC 29413 / PCC 7937) GN=potA PE=3 SV=1 51 265 4.0E-14
sp|Q9WY65|ECFA2_THEMA Energy-coupling factor transporter ATP-binding protein EcfA2 OS=Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099) GN=ecfA2 PE=1 SV=1 48 268 4.0E-14
sp|Q7VI92|METN_HELHP Methionine import ATP-binding protein MetN OS=Helicobacter hepaticus (strain ATCC 51449 / 3B1) GN=metN PE=3 SV=1 53 234 4.0E-14
sp|Q20ZS6|LOLD2_RHOPB Lipoprotein-releasing system ATP-binding protein LolD 2 OS=Rhodopseudomonas palustris (strain BisB18) GN=lolD2 PE=3 SV=1 45 253 4.0E-14
sp|Q6FCW7|PSTB_ACIAD Phosphate import ATP-binding protein PstB OS=Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1) GN=pstB PE=3 SV=1 62 267 4.0E-14
sp|Q110U3|POTA_TRIEI Spermidine/putrescine import ATP-binding protein PotA OS=Trichodesmium erythraeum (strain IMS101) GN=potA PE=3 SV=1 23 265 4.0E-14
sp|Q54R52|ABCAA_DICDI ABC transporter A family member 10 OS=Dictyostelium discoideum GN=abcA10 PE=3 SV=1 49 258 4.0E-14
sp|Q38YC1|PSTB2_LACSS Phosphate import ATP-binding protein PstB 2 OS=Lactobacillus sakei subsp. sakei (strain 23K) GN=pstB2 PE=3 SV=1 62 267 4.0E-14
sp|Q8RFN2|METN_FUSNN Methionine import ATP-binding protein MetN OS=Fusobacterium nucleatum subsp. nucleatum (strain ATCC 25586 / CIP 101130 / JCM 8532 / LMG 13131) GN=metN PE=3 SV=1 51 234 4.0E-14
sp|Q71WT2|PSTB2_LISMF Phosphate import ATP-binding protein PstB 2 OS=Listeria monocytogenes serotype 4b (strain F2365) GN=pstB2 PE=3 SV=1 62 239 4.0E-14
sp|Q927Z7|PSTB2_LISIN Phosphate import ATP-binding protein PstB 2 OS=Listeria innocua serovar 6a (strain CLIP 11262) GN=pstB2 PE=3 SV=1 62 239 4.0E-14
sp|P45171|POTA_HAEIN Spermidine/putrescine import ATP-binding protein PotA OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=potA PE=3 SV=2 42 265 4.0E-14
sp|Q72D46|PSTB_DESVH Phosphate import ATP-binding protein PstB OS=Desulfovibrio vulgaris (strain Hildenborough / ATCC 29579 / NCIMB 8303) GN=pstB PE=3 SV=1 59 239 4.0E-14
sp|Q3KCC5|FBPC_PSEPF Fe(3+) ions import ATP-binding protein FbpC OS=Pseudomonas fluorescens (strain Pf0-1) GN=fbpC PE=3 SV=1 48 289 4.0E-14
sp|Q8ZRM9|METN1_SALTY Methionine import ATP-binding protein MetN 1 OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=metN1 PE=3 SV=1 42 234 4.0E-14
sp|Q0I2Z4|FBPC_HAES1 Fe(3+) ions import ATP-binding protein FbpC OS=Haemophilus somnus (strain 129Pt) GN=fbpC PE=3 SV=1 50 266 4.0E-14
sp|Q8PAG0|PSTB_XANCP Phosphate import ATP-binding protein PstB OS=Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25) GN=pstB PE=3 SV=1 53 239 4.0E-14
sp|Q4UT63|PSTB_XANC8 Phosphate import ATP-binding protein PstB OS=Xanthomonas campestris pv. campestris (strain 8004) GN=pstB PE=3 SV=1 53 239 4.0E-14
sp|Q9K0N7|MACB_NEIMB Macrolide export ATP-binding/permease protein MacB OS=Neisseria meningitidis serogroup B (strain MC58) GN=macB PE=3 SV=1 44 238 5.0E-14
sp|Q8T5Z7|ABCA1_DICDI ABC transporter A family member 1 OS=Dictyostelium discoideum GN=abcA1 PE=2 SV=1 58 252 5.0E-14
sp|Q03AH0|POTA_LACC3 Spermidine/putrescine import ATP-binding protein PotA OS=Lactobacillus casei (strain ATCC 334) GN=potA PE=3 SV=1 53 262 5.0E-14
sp|Q5PBX2|LOLD_ANAMM Lipoprotein-releasing system ATP-binding protein LolD OS=Anaplasma marginale (strain St. Maries) GN=lolD PE=3 SV=1 41 250 5.0E-14
sp|Q32E34|MSBA_SHIDS Lipid A export ATP-binding/permease protein MsbA OS=Shigella dysenteriae serotype 1 (strain Sd197) GN=msbA PE=3 SV=1 8 266 5.0E-14
sp|Q31YT6|MSBA_SHIBS Lipid A export ATP-binding/permease protein MsbA OS=Shigella boydii serotype 4 (strain Sb227) GN=msbA PE=3 SV=1 8 266 5.0E-14
sp|Q8PSR0|Y3016_METMA Putative ABC transporter ATP-binding protein MM_3016 OS=Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88) GN=MM_3016 PE=3 SV=1 51 312 7.0E-14
sp|Q8R9L8|Y1589_CALS4 Putative ABC transporter ATP-binding protein TTE1589 OS=Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4) GN=TTE1589 PE=3 SV=1 51 231 1.0E-13
sp|P0A9U2|YBHF_SHIFL Uncharacterized ABC transporter ATP-binding protein YbhF OS=Shigella flexneri GN=ybhF PE=3 SV=1 51 289 3.0E-11
sp|P0A9U1|YBHF_ECOLI Uncharacterized ABC transporter ATP-binding protein YbhF OS=Escherichia coli (strain K12) GN=ybhF PE=1 SV=1 51 289 3.0E-11
sp|Q8TQ05|Y1747_METAC Putative ABC transporter ATP-binding protein MA_1747 OS=Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A) GN=MA_1747 PE=3 SV=1 58 310 2.0E-10
sp|Q9BZC7|ABCA2_HUMAN ATP-binding cassette sub-family A member 2 OS=Homo sapiens GN=ABCA2 PE=1 SV=3 62 260 2.0E-08
sp|Q9ESR9|ABCA2_RAT ATP-binding cassette sub-family A member 2 OS=Rattus norvegicus GN=Abca2 PE=1 SV=1 62 260 3.0E-08
sp|P41234|ABCA2_MOUSE ATP-binding cassette sub-family A member 2 OS=Mus musculus GN=Abca2 PE=1 SV=4 62 260 5.0E-08
sp|Q54HM0|ABCGG_DICDI ABC transporter G family member 16 OS=Dictyostelium discoideum GN=abcG16 PE=3 SV=1 377 539 4.0E-07
sp|P43245|MDR1_RAT Multidrug resistance protein 1 OS=Rattus norvegicus GN=Abcb1 PE=2 SV=1 58 231 4.0E-07
sp|Q9C0Y5|PDR1_SCHPO ATP-binding cassette transporter pdr1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pdr1 PE=3 SV=1 37 524 1.0E-06
sp|P12428|BROWN_DROME Protein brown OS=Drosophila melanogaster GN=bw PE=2 SV=1 229 400 1.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0005524 ATP binding Yes
GO:0016020 membrane Yes
GO:0140359 ABC-type transporter activity Yes
GO:0017076 purine nucleotide binding No
GO:0043168 anion binding No
GO:0022804 active transmembrane transporter activity No
GO:0140657 ATP-dependent activity No
GO:0043167 ion binding No
GO:0042626 ATPase-coupled transmembrane transporter activity No
GO:0003674 molecular_function No
GO:0005215 transporter activity No
GO:0032555 purine ribonucleotide binding No
GO:0110165 cellular anatomical entity No
GO:0005488 binding No
GO:0030554 adenyl nucleotide binding No
GO:0022857 transmembrane transporter activity No
GO:1901363 heterocyclic compound binding No
GO:0005575 cellular_component No
GO:0032553 ribonucleotide binding No
GO:0000166 nucleotide binding No
GO:0097367 carbohydrate derivative binding No
GO:0097159 organic cyclic compound binding No
GO:0036094 small molecule binding No
GO:0032559 adenyl ribonucleotide binding No
GO:0015399 primary active transmembrane transporter activity No
GO:0035639 purine ribonucleoside triphosphate binding No
GO:1901265 nucleoside phosphate binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 48 0.45

Transmembrane Domains

Domain # Start End Length
1 368 387 19
2 400 422 22
3 448 470 22
4 482 504 22
5 509 529 20

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|6158
MELPSSSTVVDVERQEVDEKHLVNSTVRNIAWRGVTIAVKGRKGASRKNVVDNVEGIVEAGELCALMGPSGAGKT
SLLNYLARRKITTSKVQGEVLVNGQAVSDDELYELSSFVQQEDALISTLTCFETVDFNARLSSKRRTKAERIHFV
NKLLQSFGLDSVAESFVGPFFRGSMSGGQKRRLSVASQVAGEPKILFLDEPTSGLDSTGSQQVVQYLRDLAKASN
LIIICSIHQPSAAVFHKFDKLLLVSEAKTCYFGPPSDAVEYFQEAMGNHMPPDANPAEFIIDIVSTAFSADESTS
ASSLDAMHQAWSESERAKELHSAVSATGIADGGHMSVKNLSPSRPNFVNRIAILLHRSFIKTYRDFTVYILRFAL
YLVLAIILGTAQPRLGRTQDSVQELLSLAVCSTAFASFIAVSYVPTLIEDLEHHVQEKRNGFCTSMQFSISNFLL
SLPYHFLTSVSYSLVLHALIGLNSSAPGMCTWILWLFLCLVATDSVSLLMTALVPKTNAAVALVLLYETLLIIVG
GYLVKPNTLTKFYKASFRASFFVQPTIARLDANVFISLRQQIHAKFRAPGF
Coding >Ophio5|6158
ATGGAATTGCCAAGCTCATCCACTGTTGTTGATGTTGAGCGGCAGGAGGTTGACGAAAAGCATTTGGTCAACTCG
ACTGTACGAAACATCGCTTGGCGGGGCGTCACCATCGCTGTCAAGGGTCGCAAAGGGGCCTCGAGAAAGAACGTC
GTGGACAATGTCGAGGGCATCGTTGAGGCTGGCGAGTTATGCGCTTTGATGGGCCCTTCTGGTGCCGGCAAGACC
TCTCTTTTGAACTACCTAGCCAGACGAAAAATTACAACCAGCAAGGTCCAAGGCGAGGTGCTTGTAAACGGCCAG
GCAGTGTCGGACGATGAGCTCTACGAGCTCAGTTCCTTCGTTCAGCAGGAAGATGCCTTGATCAGTACACTTACA
TGTTTCGAAACCGTCGATTTTAACGCTCGACTGTCCAGTAAGAGGCGGACGAAAGCCGAGCGCATCCACTTTGTC
AATAAACTCCTCCAGTCCTTTGGTCTCGACTCCGTAGCCGAATCCTTTGTTGGCCCATTCTTTCGAGGAAGCATG
TCGGGGGGCCAGAAGCGTCGCCTGTCCGTGGCCAGCCAGGTGGCTGGTGAACCCAAGATACTCTTCCTCGACGAG
CCTACCAGCGGGCTCGATTCGACCGGAAGTCAGCAAGTGGTGCAGTATTTGAGAGACCTGGCCAAAGCCAGCAAC
CTCATCATCATCTGCTCGATTCATCAGCCATCCGCCGCTGTTTTCCATAAATTCGACAAGTTGCTGCTGGTTTCC
GAAGCCAAAACATGCTACTTCGGTCCTCCAAGTGATGCTGTGGAATATTTCCAAGAAGCCATGGGTAACCACATG
CCGCCCGATGCTAATCCTGCCGAATTTATCATCGATATAGTCAGCACTGCTTTCTCCGCAGACGAATCGACTTCG
GCCTCATCTCTTGACGCCATGCATCAAGCTTGGAGCGAATCCGAGCGTGCGAAAGAGCTTCACAGTGCAGTTTCC
GCCACGGGCATTGCGGACGGGGGGCACATGTCGGTCAAGAACCTGTCGCCGTCTCGGCCAAATTTTGTCAATCGG
ATCGCAATCTTGCTTCATCGCAGCTTTATCAAGACCTACCGAGACTTTACAGTCTACATTCTTCGGTTCGCTCTG
TACCTCGTCCTGGCCATCATCCTCGGCACAGCTCAGCCACGCCTTGGCCGGACTCAAGATTCGGTTCAAGAGCTT
TTGAGCCTCGCAGTGTGTTCTACTGCATTCGCTTCCTTTATAGCAGTGTCTTACGTTCCGACTCTCATCGAAGAC
TTGGAACACCATGTCCAAGAAAAGCGCAACGGCTTTTGCACTTCTATGCAGTTTTCAATCTCAAATTTTCTTCTG
AGCTTACCATATCATTTCTTGACCTCTGTCTCGTATTCCCTTGTTCTTCATGCCTTGATTGGTCTGAACAGTTCT
GCTCCAGGAATGTGCACCTGGATTCTATGGCTGTTCCTTTGTCTGGTGGCAACTGATTCTGTATCCCTCCTCATG
ACGGCCTTGGTCCCCAAGACCAATGCAGCCGTGGCTCTTGTGCTGCTTTATGAAACTCTTCTGATTATTGTTGGG
GGGTATTTGGTGAAGCCTAACACACTAACAAAGTTCTACAAGGCCTCGTTTCGAGCCAGCTTCTTCGTTCAACCT
ACGATTGCGCGCCTGGATGCCAATGTCTTTATCAGCCTACGTCAGCAAATTCATGCAAAATTTCGGGCACCAGGA
TTT
Transcript >Ophio5|6158
ATGGAATTGCCAAGCTCATCCACTGTTGTTGATGTTGAGCGGCAGGAGGTTGACGAAAAGCATTTGGTCAACTCG
ACTGTACGAAACATCGCTTGGCGGGGCGTCACCATCGCTGTCAAGGGTCGCAAAGGGGCCTCGAGAAAGAACGTC
GTGGACAATGTCGAGGGCATCGTTGAGGCTGGCGAGTTATGCGCTTTGATGGGCCCTTCTGGTGCCGGCAAGACC
TCTCTTTTGAACTACCTAGCCAGACGAAAAATTACAACCAGCAAGGTCCAAGGCGAGGTGCTTGTAAACGGCCAG
GCAGTGTCGGACGATGAGCTCTACGAGCTCAGTTCCTTCGTTCAGCAGGAAGATGCCTTGATCAGTACACTTACA
TGTTTCGAAACCGTCGATTTTAACGCTCGACTGTCCAGTAAGAGGCGGACGAAAGCCGAGCGCATCCACTTTGTC
AATAAACTCCTCCAGTCCTTTGGTCTCGACTCCGTAGCCGAATCCTTTGTTGGCCCATTCTTTCGAGGAAGCATG
TCGGGGGGCCAGAAGCGTCGCCTGTCCGTGGCCAGCCAGGTGGCTGGTGAACCCAAGATACTCTTCCTCGACGAG
CCTACCAGCGGGCTCGATTCGACCGGAAGTCAGCAAGTGGTGCAGTATTTGAGAGACCTGGCCAAAGCCAGCAAC
CTCATCATCATCTGCTCGATTCATCAGCCATCCGCCGCTGTTTTCCATAAATTCGACAAGTTGCTGCTGGTTTCC
GAAGCCAAAACATGCTACTTCGGTCCTCCAAGTGATGCTGTGGAATATTTCCAAGAAGCCATGGGTAACCACATG
CCGCCCGATGCTAATCCTGCCGAATTTATCATCGATATAGTCAGCACTGCTTTCTCCGCAGACGAATCGACTTCG
GCCTCATCTCTTGACGCCATGCATCAAGCTTGGAGCGAATCCGAGCGTGCGAAAGAGCTTCACAGTGCAGTTTCC
GCCACGGGCATTGCGGACGGGGGGCACATGTCGGTCAAGAACCTGTCGCCGTCTCGGCCAAATTTTGTCAATCGG
ATCGCAATCTTGCTTCATCGCAGCTTTATCAAGACCTACCGAGACTTTACAGTCTACATTCTTCGGTTCGCTCTG
TACCTCGTCCTGGCCATCATCCTCGGCACAGCTCAGCCACGCCTTGGCCGGACTCAAGATTCGGTTCAAGAGCTT
TTGAGCCTCGCAGTGTGTTCTACTGCATTCGCTTCCTTTATAGCAGTGTCTTACGTTCCGACTCTCATCGAAGAC
TTGGAACACCATGTCCAAGAAAAGCGCAACGGCTTTTGCACTTCTATGCAGTTTTCAATCTCAAATTTTCTTCTG
AGCTTACCATATCATTTCTTGACCTCTGTCTCGTATTCCCTTGTTCTTCATGCCTTGATTGGTCTGAACAGTTCT
GCTCCAGGAATGTGCACCTGGATTCTATGGCTGTTCCTTTGTCTGGTGGCAACTGATTCTGTATCCCTCCTCATG
ACGGCCTTGGTCCCCAAGACCAATGCAGCCGTGGCTCTTGTGCTGCTTTATGAAACTCTTCTGATTATTGTTGGG
GGGTATTTGGTGAAGCCTAACACACTAACAAAGTTCTACAAGGCCTCGTTTCGAGCCAGCTTCTTCGTTCAACCT
ACGATTGCGCGCCTGGATGCCAATGTCTTTATCAGCCTACGTCAGCAAATTCATGCAAAATTTCGGGCACCAGGA
TTTTAG
Gene >Ophio5|6158
ATGGAATTGCCAAGCTCATCCACTGTTGTTGATGTTGAGCGGCAGGAGGTTGACGAAAAGCATTTGGTCAACTCG
ACTGTACGAAACATCGCTTGGCGGGGCGTCACCATCGCTGTCAAGGGTCGCAAAGGGGCCTCGAGAAAGAACGTC
GTGGACAATGTCGAGGGCATCGTTGAGGCTGGTAAGCACCAAACAATACACGGGCATGGCTCTCAAAAAAAAAAA
AAAAAAAAAATTGGCGTGTTCATCCCGCCCGTGCCGGAGAAAAAGCTACGAGTTACTGATGTTGTCCTCTAGGCG
AGTTATGCGCTTTGATGGGCCCTTCTGGTGCCGGCAAGACCTCTCTTTTGAACTACCTAGCCAGACGAAAAATTA
CAACCAGCAAGGTCCAAGGCGAGGTGCTTGTAAACGGCCAGGCAGTGTCGGACGATGAGCTCTACGAGCTCAGTT
CCTTCGTTCAGCAGGAAGATGCCTTGATCAGTACACTTACATGTTTCGAAACCGTCGATTTTAACGCTCGACTGT
CCAGTAAGAGGTACGTTTTTTTCTTCTTCATTTTAAAACCCCTTTGATCCTCAATCTTCCATCTCGTTCCAATCT
CATGTCTGTTGAAAACTGATCTGGGAGCCAAGGCGGACGAAAGCCGAGCGCATCCACTTTGTCAATAAACTCCTC
CAGTCCTTTGGTCTCGACTCCGTAGCCGAATCCTTTGTTGGCCCATTCTTTCGAGGAAGCATGTCGGGGGGCCAG
AAGCGTCGCCTGTCCGTGGCCAGCCAGGTGGCTGGTGAACCCAAGATACTCTTCCTCGACGAGCCTACCAGCGGG
CTCGATTCGACCGGAAGTCAGCAAGTGGTGCAGTATTTGAGAGACCTGGCCAAAGCCAGCAACCTCATCATCATC
TGCTCGATTCATCAGCCATCCGCCGCTGTTTTCCATAAATTCGACAAGTTGCTGCTGGTTTCCGAAGCCAAAACA
TGCTACTTCGGTCCTCCAAGTGATGCTGTGGAATATTTCCAAGAAGCCATGGGTAACCACATGCCGCCCGATGCT
AATCCTGCCGAATTTATCATCGATATAGTCAGCACTGCTTTCTCCGCAGACGAATCGACTTCGGCCTCATCTCTT
GACGCCATGCATCAAGCTTGGAGCGAATCCGAGCGTGCGAAAGAGCTTCACAGTGCAGTTTCCGCCACGGGCATT
GCGGACGGGGGGCACATGTCGGTCAAGAACCTGTCGCCGTCTCGGCCAAATTTTGTCAATCGGATCGCAATCTTG
CTTCATCGCAGCTTTATCAAGACCTACCGAGACTTTACAGTCTACATTCTTCGGTTCGCTCTGTACCTCGTCCTG
GCCATCATCCTCGGCACAGCTCAGCCACGCCTTGGCCGGACTCAAGATTCGGTTCAAGAGCTTTTGAGCCTCGCA
GTGTGTTCTACTGCATTCGCTTCCTTTATAGCAGTGTCTTACGTTCCGACTCTCATCGAAGACTTGGAACACCAT
GTCCAAGAAAAGCGCAACGGCTTTTGCACTTCTATGCAGTTTTCAATCTCAAATTTTCTTCTGAGCTTACCATAT
CATTTCTTGACCTCTGTCTCGTATTCCCTTGTTCTTCATGCCTTGATTGGTCTGAACAGTTCTGCTCCAGGAATG
TGCACCTGGATTCTATGGCTGTTCCTTTGTCTGGTGGCAACTGATTCTGTATCCCTCCTCATGACGGCCTTGGTC
CCCAAGACCAATGCAGCCGTGGCTCTTGTGCTGCTTTATGAAACTCTTCTGATTATTGTTGGGGGGTATTTGGTG
AAGCCTAACACACTAACAAAGTTCTACAAGTACGCCCTTTACCACTCGAATTTCTTGTCCTGTTCTTTTCAGGGC
CTCGTTTCGAGCCAGCTTCTTCGTTCAACCTACGATTGCGCGCCTGGATGCCAATGTCTTTATCAGCCTACGTCA
GCAAATTCATGCAAAATTTCGGGCACCAGGATTTTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail